KEGG   Bdellovibrio exovorus: A11Q_2263Help
Entry
A11Q_2263         CDS       T02492                                 

Definition
(GenBank) flavoprotein
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
bex  Bdellovibrio exovorus
Pathway
bex00770  Pantothenate and CoA biosynthesis
bex01100  Metabolic pathways
Module
bex_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bex00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    A11Q_2263
Enzymes [BR:bex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     A11Q_2263
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     A11Q_2263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein DFP DUF1820
Motif
Other DBs
NCBI-ProteinID: AGH96479
UniProt: M4VTH2
Position
2306583..2307842
Genome map
AA seq 419 aa AA seqDB search
MSPSNKSKNILIVMTGSIACYKVCTVMSRLKQAQHHVKVVMSPSSLAFVGAATVEGLTGE
MPITDMYARGNVMDHINLVRWADLILVAPATANYINKIAYGLGDDLLTTLFLAHDFAKPF
LLAPAMNTKMYQHPTTQDSIKKLRAMGVEILETASGVLACGEVGSGRLLEPDLILEEVYQ
RVGSTTSVTDKSSGSESKTPATARKVLITAGGTSEAIDDVRVITNRSTGRTAAHLADILI
ESGFKVTYLHSTQSILPQNTCNKISYDSFTDLQTALKATLQQELFHVVIHAAAVSDYSVQ
RQGGKISSQADEITLTLKKNPKIIDEIKKLSPQTLLFGFKLTSKITGDDVKQKVQSLLKS
ADCDFVVQNDWDEVSQKKEHYHVYNRDLQSTEVTGLTELGQFIFQKTIALLPELKMETL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatctaataagagtaaaaacattctaattgtcatgaccggttctatcgcctgc
tacaaagtgtgcacggtgatgtcgcgcctcaagcaagctcagcatcacgttaaagtggtg
atgtcacccagcagtttagcctttgttggtgcagccactgtggaaggactcaccggagaa
atgccgataacagatatgtatgctcgcggaaacgtgatggatcatatcaatttagttcgc
tgggctgatttaattttagtagctccagccacggcaaattacatcaataaaatcgcctat
ggcttaggtgatgatttattaacaaccttgtttttggcccatgattttgcaaaaccattt
ttgttggcgccggcgatgaatacgaaaatgtatcagcaccctacaacacaggactcaatt
aaaaaactacgcgccatgggtgttgaaattttagaaacggcttcaggcgttttagcctgc
ggcgaagtgggctctggtcgcttactagaaccagatctgattttagaggaagtttatcag
cgcgtaggaagtacaacctcggtcactgataaatcctcgggctcagaatcaaaaactcca
gctacggctcgtaaagtcttgattacggctggtggtacctctgaggcgattgatgatgtg
cgtgtgattacgaatcgcagtacaggacgaacagcagctcacttagctgatattttgatt
gagtctggatttaaggttacttatctgcacagcacacagtccattctgccacagaatact
tgcaacaaaatcagctacgatagttttaccgatttgcaaacagctttgaaagcaactctt
caacaagaattgtttcatgtggtgatccatgccgctgccgtcagtgattactcagtccaa
cgacaaggaggaaaaatcagcagtcaggctgatgaaatcacattgacgttgaagaaaaat
cctaaaatcatcgacgagattaaaaaactttccccacagactcttttgttcggctttaaa
ctaacttcgaaaataacaggcgacgacgttaaacaaaaagtacaaagcctattaaaatcg
gcagactgtgattttgttgttcaaaacgattgggatgaagtcagtcaaaagaaagagcat
tatcatgtctataatcgtgatcttcaatcgacagaagtcactggcctcaccgaactcggc
caatttatttttcaaaaaaccatagctttattaccagaattaaaaatggagactttatga

DBGET integrated database retrieval system