KEGG   Bdellovibrio exovorus: A11Q_558Help
Entry
A11Q_558          CDS       T02492                                 

Definition
(GenBank) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bex  Bdellovibrio exovorus
Pathway
bex00480  Glutathione metabolism
bex00590  Arachidonic acid metabolism
bex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bex00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A11Q_558
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A11Q_558
Enzymes [BR:bex01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A11Q_558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AGH94778
UniProt: M4V6F0
Position
complement(545893..546384)
Genome map
AA seq 163 aa AA seqDB search
MSTEKNFYDYSVKAAGASNYNLEQHRGKVALVVNVASKCGFTPQYKGLEELYQNFSHDQF
VILGFPCNQFGFQEPGSDSEIQQFCSLTYSVTFPVLSKVDVNGGEADPVYQFMKEKAPGV
LGTEAIKWNFTKFLIGKDGQVLKRYAPNTEPKDIKADIEAALK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagaaaaaaacttctacgattactcagtaaaagcagctggtgccagcaactac
aacttagaacagcaccgcggaaaagtcgctttggtcgtgaacgtggccagtaagtgtgga
ttcactccacagtacaaaggacttgaagagctttaccaaaacttttcacacgatcaattt
gttatcctaggctttccttgcaaccaattcggctttcaagagcccggctctgacagcgaa
atccaacagttctgctcattaacttatagcgtgactttccccgttttaagtaaggtcgat
gtgaatggtggcgaagctgatcctgtctatcagtttatgaaagaaaaagcccctggtgtt
ttaggcactgaagctattaaatggaacttcaccaagttcttaattggcaaagatgggcag
gtgttaaaacgctatgcacctaatacagagccaaaagatattaaagccgacatagaagcc
gcactgaaatag

DBGET integrated database retrieval system