KEGG   Bdellovibrio exovorus: A11Q_777Help
Entry
A11Q_777          CDS       T02492                                 

Definition
(GenBank) putative amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bex  Bdellovibrio exovorus
Brite
KEGG Orthology (KO) [BR:bex00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A11Q_777
Enzymes [BR:bex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     A11Q_777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase DUF5099
Motif
Other DBs
NCBI-ProteinID: AGH94995
UniProt: M4V988
Position
769380..770189
Genome map
AA seq 269 aa AA seqDB search
MKIGIAQLNSNDDVRSNFEQIKQIILSSEKEKPEIIFFPENSLFFRISNDKNLEAISLED
QVIVDLQVLCAKQQVAIHLTTAVKENGKVYNATIFIDKNGVAKTVYKKIHLFDIELQDQK
PIRESDVFAGGSETSTIQVADFKIGNSICYDVRFAELYSKYAKQDVDLIVIPAAFLVKTG
MVHWDVLLRARAIESQCYVVAPAQAGEHQSSLGPWKRETYGHSMLVSPWGETLALKPDGV
GIIYAELDLNLIRNVRKQIPMKNHRRIDF
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaagattggcattgcgcagcttaatagcaatgatgatgtccgctctaacttcgaacag
atcaagcaaatcatattaagctctgaaaaagaaaagcccgagattattttctttcccgag
aactcacttttttttcgcatatccaatgataaaaatttagaagctatttctttagaagac
caagtgatcgttgatttacaagtactttgcgctaaacaacaggtagctatacatctgaca
acggcagtaaaagaaaatggcaaggtctataacgccacaatcttcatcgataagaatggt
gtagcgaaaactgtatataaaaaaattcatctatttgatattgagctacaagatcagaag
cctattcgagaatctgatgtttttgctggtggcagtgaaaccagtacaattcaagtggcc
gattttaagattggtaattctatatgttacgatgtccgttttgcagagctttactcaaag
tatgctaagcaagatgtggatttaatcgtgatcccagcagcttttctagtgaaaaccgga
atggttcattgggatgtcttattacgtgctcgggctattgagtcccagtgttatgtggtg
gctccggcacaggccggagagcaccaatccagcttagggccatggaagcgggaaacttat
ggacactctatgctcgtcagcccttggggggaaaccttggctcttaagcctgatggggtt
ggtattatctatgcggaattagatctgaatttaatacgcaatgtacgtaaacaaattcct
atgaaaaaccatagaagaattgatttctga

DBGET integrated database retrieval system