KEGG   Brachybacterium faecium: Bfae_08200Help
Entry
Bfae_08200        CDS       T00965                                 

Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00620  Pyruvate metabolism
bfa00630  Glyoxylate and dicarboxylate metabolism
bfa01100  Metabolic pathways
bfa01110  Biosynthesis of secondary metabolites
bfa01120  Microbial metabolism in diverse environments
bfa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bfae_08200
   00630 Glyoxylate and dicarboxylate metabolism
    Bfae_08200
Enzymes [BR:bfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bfae_08200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 8399368
NCBI-ProteinID: YP_003154264
UniProt: C7M9Y0
Position
complement(933862..935493)
Genome map
AA seq 543 aa AA seqDB search
MSTITTPSAVEATRPEGLAQAEEILSAEALDFVAELHRRFDARRLELLAQRTEKRREAAE
RGRLDFLESTRSIREDESWSVPEAPPALRDRRVEITGPAMPAKMAINALNSGAKVWLADL
EDASSPTWLNQVGGILNLRDAAHGTLAFTSPEGKQYRLREDEPSAVVVARPRGLHLPEHN
VRIDGAPASASLVDFGLHFFHTAAALSEKDRGPYYYLPKLESHLEAKLWNEVFTYAEERL
GIAHGTVRATVLIETIPAAFEMEEILYELREHASGLNAGRWDYLFSIIKTFRDAGERFQL
ADRSTVTMTAPLMRAYTDLLVRTCHRRGAVAMGGMAAFIPNRREPEVTAAAFESVRQDKT
REARDGFDGSWVAHPDLVEICREVFDGVLGERPHQIDRTREDVEVTADQLLDVASAGEVR
TEKELHLNLYVAFRYVAVWLSGNGAVAINNLMEDAATAEISRSQVWQQIHNGVVYRDTGN
TATRELVEEAIAAQSETIRRELGGIEELAAHIEPAIELVTRLVLDEEYQDFLTLPAYEFM
EAR
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatcaccaccccctcggccgtcgaggccaccagaccggagggcctcgcgcag
gccgaggagatcctcagcgccgaggcgctggacttcgtcgccgagctgcaccgccgcttc
gacgcgcggcgcctcgagctcctcgcccagcgcaccgagaagcgccgcgaggccgcggag
cgcggccgactcgacttcctggagtcgacccgctcgatccgcgaggacgagagctggtcg
gtccccgaggcgccgcccgccctccgggaccgccgcgtcgagatcaccggcccggccatg
cccgcgaagatggcgatcaacgccctgaactccggggcgaaggtctggctcgcggacctc
gaggacgcctcgagcccgacctggctcaaccaggtcggcggcatcctgaacctccgcgac
gccgcgcacgggacgctcgccttcacctccccggaggggaagcagtaccgcctgcgcgag
gacgagccgtccgccgtggtcgtcgcccgcccgcgcgggctgcacctgcccgagcacaac
gtgcgcatcgacggagcacccgcctccgcctccctggtcgacttcggcctgcacttcttc
cacaccgccgccgcgctgtccgagaaggaccgcggcccgtactactacctgcccaagctc
gagtcccacctcgaggcgaagctctggaacgaggtgttcacctacgccgaggagcgcctc
gggatcgcgcacggcaccgtccgggccaccgtcctcatcgagaccatccccgccgccttc
gagatggaggagatcctctacgagctgcgcgagcacgcctccggcctgaacgcgggccgc
tgggactacctcttcagcatcatcaagacgttccgcgatgccggggagaggttccagctc
gccgaccgctcgaccgtcacgatgaccgccccgctcatgcgggcctacacggacctgctc
gtgcgcacgtgccaccgtcgcggcgcggtcgccatgggaggcatggccgcgttcatcccc
aaccgccgcgagccggaggtcaccgccgcggccttcgagagcgtccgccaggacaagacc
cgcgaggcccgggacggcttcgacggatcgtgggtggcccaccccgacctcgtcgagatc
tgccgagaggtgttcgacggcgtgctcggcgagcgaccccaccagatcgaccgcacccgc
gaggacgtcgaggtcaccgccgatcagctgctcgacgtcgcgagcgcgggagaggtgcgg
accgagaaggagctgcacctgaacctctacgtcgccttccgctacgtcgcggtgtggctc
tcgggcaacggagcggtggcgatcaacaacctcatggaggacgcggccaccgccgagatc
tcgcgctcgcaggtctggcagcagatccacaacggcgtcgtctaccgggacaccgggaac
accgcgacccgcgagctcgtcgaggaggccatcgcggcgcagagcgagacgatccgccgg
gagctcggcgggatcgaggagctcgccgcgcacatcgagccggcgatcgagctggtgacc
cgtctcgtgctggacgaggagtaccaggacttcctgaccctgcccgcctacgagttcatg
gaggcccgatga

DBGET integrated database retrieval system