KEGG   Brachybacterium faecium: Bfae_09090Help
Entry
Bfae_09090        CDS       T00965                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00020  Citrate cycle (TCA cycle)
bfa00640  Propanoate metabolism
bfa00660  C5-Branched dibasic acid metabolism
bfa01100  Metabolic pathways
bfa01110  Biosynthesis of secondary metabolites
bfa01120  Microbial metabolism in diverse environments
bfa01130  Biosynthesis of antibiotics
bfa01200  Carbon metabolism
Module
bfa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bfa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bfae_09090 (sucC)
   00640 Propanoate metabolism
    Bfae_09090 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Bfae_09090 (sucC)
Enzymes [BR:bfa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bfae_09090 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 8399457
NCBI-ProteinID: YP_003154353
UniProt: C7MAK5
Position
1029936..1031105
Genome map
AA seq 389 aa AA seqDB search
MDLYEYQARDLFEKHGVPVLGGVVAEDPAAAKAGAEKLGTPVVVVKAQVKTGGRGKAGGV
KIAKSPEEAEQKASEILGMDIKGHTVHRVMIAAGADIAEEYYFSLLLDRANRNYLAMCSV
EGGMEIEQLAVERPEALARVAVDPNVGIDQAKAEEIVAAAKFDAETGAKVAPVLVKLWDA
YREEDATLVEVNPLVKTGDGEIVALDGKITLDDNAQFRQEGHSELVDVASEDPLETKAKS
LDLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGVKPANFLDIGGGASAEVMANGLD
VILGDEQVSAVFVNVFGGITACDAVANGIVGALKKLGDAATKPLVVRLDGNNVEEGRSIL
ADFAHPLVTQADTMDGGAAKVAELAAAGK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtatgagtaccaggcccgcgatctcttcgagaagcacggcgttcccgtgctc
ggaggagtcgtcgcggaggatcctgcagccgccaaggccggagccgagaagctcggcacc
ccggtcgtcgtcgtcaaggcccaggtgaagaccggtggccgcggcaaggccggcggcgtg
aagatcgccaagtcccccgaggaagcggagcagaaggcctccgagatcctaggcatggac
atcaagggccacaccgtgcaccgcgtcatgatcgccgccggcgcggacatcgccgaggag
tactacttctcgctgctgctggaccgtgcgaaccgcaactacctggccatgtgctccgtc
gagggcggcatggagatcgagcagctcgccgtcgagcgccccgaggccctcgcccgcgtc
gccgtcgaccccaacgtcggcatcgaccaggccaaggccgaggagatcgtcgccgcggcg
aagttcgatgccgagaccggtgcgaaggtcgctcccgtgctggtgaagctgtgggacgcc
taccgcgaggaggacgcgaccctcgtcgaggtcaacccgctggtcaagaccggtgacggc
gagatcgtcgccctcgacggcaagatcaccctcgacgacaacgcgcagttccgccaggag
ggccactccgagctcgtcgacgtcgcctccgaggatccgctcgagaccaaggccaagtcc
ctggacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggcgcgggc
ctggtcatgtccaccctcgacgtggtcgcctacgcgggcgagaagcacggcgtgaagccc
gcgaacttcctcgacatcggcggcggcgcctccgccgaggtgatggccaacggcctcgac
gtcatcctcggcgacgagcaggtctccgccgtgttcgtcaacgtcttcggcggcatcacc
gcctgcgacgcggtcgccaacggcatcgtcggcgccctgaagaagctcggcgacgcggcg
accaagccgctcgtggtccgtctcgacggcaacaacgtcgaggagggtcgcagcatcctc
gccgacttcgcccatcctctcgtcacccaggccgacaccatggacggcggcgccgcgaag
gtcgccgagctcgccgccgcaggaaagtga

DBGET integrated database retrieval system