KEGG   Brachybacterium faecium: Bfae_11020Help
Entry
Bfae_11020        CDS       T00965                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00010  Glycolysis / Gluconeogenesis
bfa00030  Pentose phosphate pathway
bfa00051  Fructose and mannose metabolism
bfa00052  Galactose metabolism
bfa00680  Methane metabolism
bfa01100  Metabolic pathways
bfa01110  Biosynthesis of secondary metabolites
bfa01120  Microbial metabolism in diverse environments
bfa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bfae_11020
   00030 Pentose phosphate pathway
    Bfae_11020
   00051 Fructose and mannose metabolism
    Bfae_11020
   00052 Galactose metabolism
    Bfae_11020
  Energy metabolism
   00680 Methane metabolism
    Bfae_11020
Enzymes [BR:bfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bfae_11020
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Bfae_11020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-GeneID: 8399650
NCBI-ProteinID: YP_003154540
UniProt: C7MBH7
Position
complement(1240984..1242012)
Genome map
AA seq 342 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGAVLKGDQQFEDEFIGYRDGWRGVIDDDWMTLPRRRVRGI
GRIGGTILGTSRSNPFADGEDGAEIVRRQMEDNDIDGIIAIGGDGTLFTANRLFESGIPV
IGVPKTVDNDLDATDYTFGFNTAVEIATESLDRLRITGDSHHRCMVAEVMGRSVGWIALH
SGMAAGAHVICLPEFPLTLDEICTYVTSAFKRGRAPLVVVAEGFVPADAPEGFIDYELDE
FGRPRFGGIAEVLAPLIEQRLGIESRATVLGHIQRGGEPTGYDRVLATRLGTAALDLAHQ
GGFGRMVALRGTDIVDVPLTEAIDSVKRVPESRWREAEVLFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggaatcctcacctccggcggcgactgccccggcctgaacgccgtgatccgc
ggcgcggtgctcaagggtgatcagcagttcgaggacgagttcatcggctaccgcgacgga
tggcgcggcgtcatcgacgacgactggatgacgctgccgcgccggcgcgtgcggggcatc
ggccggatcggcggcacgatcctgggcacctcccgctctaaccccttcgctgacggggag
gacggcgcggagatcgtgcgccggcagatggaggacaacgacatcgacgggatcatcgcg
atcggcggggacggcaccctgttcaccgcgaaccggctcttcgaatccgggatcccggtg
atcggcgtccccaagacggtcgacaacgacctggacgccacggactacaccttcggcttc
aacaccgccgtggagatcgccaccgaatcgctggaccgcctgcggatcacgggcgactcc
caccaccgctgcatggtggcggaggtgatggggcgcagcgtgggctggatcgcgctgcac
tcggggatggcggcaggcgcccacgtgatctgcctgcccgagttcccgctcaccctcgac
gagatctgcacctatgtgacctctgccttcaagcgcggccgagcaccgctggtggtcgtg
gccgaggggttcgtccccgcggacgccccggagggcttcatcgactacgagctcgacgag
ttcggccggccccgcttcggcgggatcgccgaggtgctcgccccgctgatcgagcagcgc
ctggggatcgagtcccgggcgacggtgctgggccacatccagcgcggcggcgagcccacg
ggatacgaccgcgtcctggccacccgtctcggcacggccgcgctggacctcgcgcaccag
ggcggcttcggcaggatggtcgcgctgcgcggcacggacatcgtggacgtgccgctcacc
gaggcgatcgacagcgtcaagcgcgtgccggagtcccgctggcgcgaggccgaggtgctc
ttcggctga

DBGET integrated database retrieval system