KEGG   Brachybacterium faecium: Bfae_15800Help
Entry
Bfae_15800        CDS       T00965                                 

Definition
(RefSeq) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00040  Pentose and glucuronate interconversions
bfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bfae_15800
Enzymes [BR:bfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     Bfae_15800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 8400127
NCBI-ProteinID: YP_003154998
UniProt: C7MCV1
Position
1783688..1784719
Genome map
AA seq 343 aa AA seqDB search
MRALMLHEKNRMSIEEVEPVGSPGPGEVRIAMHTVGICASDVHYWTDGKIGPFVVEAPMI
LGHEGAGTVLEVGEGVTYLAPGDRVAMEPGVPDPTSRAVKEGNYNVDPGVQFWATPPVHG
CLADEVLHSAAYTYKLPDSLSFAEGALIEPFAVGMYAATKAEISPGDVAAVVGAGTIGIM
TALAARAGGASTVYISDVLPQKLALLDGLEGIVTVDATKEDLGQRVREATGGWGPQVVFE
ATGAAPAYKDLWSLPAPGGRIVLVGMPVDPVPFDIATAQSRGVSLETVFRYANVYQKAID
LAASDAVDLSRFVSETFAFDDSVGAFERFLEGRPTDVKIQIAL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctgatgctgcacgagaagaaccgcatgtccatcgaggaggtcgagcccgtc
ggctcgcccggaccgggcgaggtgcggatcgcgatgcacaccgtcggcatctgcgcctcg
gacgtgcactactggaccgacggcaagatcggcccctttgtggtcgaggcgccgatgatc
ctcgggcacgagggtgccgggacggtgctcgaggtgggcgagggcgtcacctacctcgcc
cccggggatcgggtcgcgatggagcccggcgtgccggacccgacctcccgcgccgtcaag
gagggcaactacaacgtggatccgggcgtgcagttctgggcgaccccgcccgtgcacggc
tgtctcgccgacgaggtgctccactccgccgcgtacacctacaagctgccggacagcctc
agcttcgccgagggcgcgctgatcgagccgttcgccgtggggatgtacgcggcgaccaag
gcggagatctcccccggcgatgtcgccgcggtggtcggcgccggcaccatcggcatcatg
accgcgctcgccgcccgcgccggcggtgccagcaccgtgtacatctccgacgtgctcccc
cagaagctcgcgctgctcgacgggctcgagggcatcgtcacggtcgatgcgacgaaggag
gatctcggccagcgggtgcgcgaggcgacgggcggctggggcccgcaggtggtcttcgag
gccaccggcgccgcccccgcgtacaaggacctctggtcgctgcccgcccccggcggccgc
atcgtgctggtggggatgccggtggatcccgtgcccttcgacatcgccaccgcgcagagc
cgcggagtgtccctcgagacggtgttccgctacgcgaacgtgtaccagaaggcgatcgac
ctcgccgcgagcgatgccgtggacctctcccgcttcgtcagcgagaccttcgccttcgac
gattcggtgggcgccttcgagcggttcctcgagggccggccgacggatgtgaagatccag
atcgcgctgtga

DBGET integrated database retrieval system