KEGG   Bacteroides fragilis BOB25: VU15_10810Help
Entry
VU15_10810        CDS       T03897                                 

Definition
(GenBank) cobalamin biosynthesis protein CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
bfb  Bacteroides fragilis BOB25
Pathway
bfb00860  Porphyrin and chlorophyll metabolism
bfb01100  Metabolic pathways
Module
bfb_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bfb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VU15_10810
Enzymes [BR:bfb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     VU15_10810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase Peptidase_S51 DUF3037
Motif
Other DBs
NCBI-ProteinID: AKA52151
Position
complement(2706124..2707611)
Genome map
AA seq 495 aa AA seqDB search
MNKNLHPLMLAGTGSDVGKSIIAAAFCRIFLQDGYHPAPFKAQNMALNSYATPEGLEIGR
AQAVQAEAAGVPCHTDMNPLLLKPSSDHTSQVVLNGRPIGNRNAYEYFRREGREELRKEV
HAAFDRLAARYNPVVMEGAGSISEINLRDSDLVNLPMAMHAGADVILVADIDRGGVFASV
YGSVMLLRPEERKHIKGILINKFRGDIRLFESGVKMLEDLCGVPVVGVVPYYKDIYIEEE
DSVMLQTKNIRAGQGKVNVAVVLLCHLSNFTDFNVLERDPRVHLFYTNNTDELMKADIIL
LPGSKSTLSDLYELRRNGVAQAIVRAHREGATVMGICGGYQLMGREVCDPDHVEGEIERL
PGLGLLPVSTRMQGEKVTRQVRFRFLEDSAVCEGYEIHMGTTTPLADVPVSPLNHLADGR
EDGYFVDRTCMGTYVHGILDNPSVIDYLLEPFADKLKETAFDYKAFKEEQYDKLAAHVRK
HVDLPLIYQILTDND
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaacttacaccctttgatgctggccggaaccggtagcgatgtaggcaaaagc
atcattgccgcagctttctgccgtatatttctgcaagacggttatcatccggcaccattc
aaagcacaaaacatggcattgaactcttatgccactcccgaaggacttgaaataggaagg
gcgcaagccgtgcaggccgaggccgcaggtgtgccttgccatacggatatgaacccgttg
cttctgaaaccatcgtccgatcatacttcacaggtggtgctcaacggacgtcccatcggc
aatcggaatgcttacgaatatttccgccgtgaagggcgggaggaattgcgaaaagaggtt
catgccgcattcgaccgtttggctgcccgatataatccggtagtgatggagggagcgggg
agtatctccgagatcaatcttcgtgacagcgatctggtgaatctgcccatggccatgcat
gccggggcagatgtgattctcgtggctgatatagaccgtggaggagtgtttgccagtgtt
tacggttcggtgatgctgcttcggccggaagagcggaagcatatcaaggggatattgatt
aataaattccgtggagatatccgccttttcgagtcgggggtaaagatgctggaagatctt
tgtggtgttccggtggttggggtggtgccctactataaagatatctatattgaggaagaa
gactcggtgatgcttcagaccaagaatatccgtgccggacaaggcaaagtgaatgtggct
gtcgtgttgctttgtcatttaagcaatttcaccgacttcaatgtcttggagcgcgatccg
cgtgtacacctgttctacaccaacaatacggacgagttgatgaaagcggatatcatcctg
ttgcccggttcgaaaagcactttgtccgatctgtatgagttgcgccgcaacggagtggcg
caggccatcgtccgtgctcaccgcgaaggtgccacggtaatgggcatttgtggaggttac
caactgatgggtagggaggtttgcgatcccgatcatgtggaaggcgagatagaacgcttg
ccgggattggggttactgcctgtcagcacccgcatgcagggagagaaggttacccgccag
gtacggtttcgttttcttgaagacagcgctgtctgcgaaggatacgaaatacacatggga
acgaccacgccccttgcggatgttcctgtttctccactcaaccatctggcggatggaagg
gaggatgggtattttgtagaccgcacctgcatgggaacatacgtacatggcattctcgac
aatccttcagttatcgattacctgctggagcctttcgccgataaactgaaagagacggct
tttgattacaaagcatttaaagaagaacaatacgataaactggcagcccatgtccgtaag
cacgtcgacttgccgcttatctatcaaatattgacagacaatgattga

DBGET integrated database retrieval system