KEGG   Bacteroides fragilis BOB25: VU15_20130Help
Entry
VU15_20130        CDS       T03897                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
bfb  Bacteroides fragilis BOB25
Pathway
bfb00010  Glycolysis / Gluconeogenesis
bfb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VU15_20130
Enzymes [BR:bfb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     VU15_20130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase NIF IL4_i_Ig
Motif
Other DBs
NCBI-ProteinID: AKA53764
UniProt: A0A149NMJ9
Position
complement(4867634..4868257)
Genome map
AA seq 207 aa AA seqDB search
MKRKGIKNLIFDFGGVLINLDRQRCIENFRKLGLEKVDELLGMYSQQGIFMQHEKGLISS
AQFRDSIRGQITQEVTDEQIDAAWNSFLVDIPRFKLDMLLKLREKYVVYLLSNTNEIHWK
WACEHAFPYRGFRVEDYFEKMYLSYEMKMVKPAEEIFRGVLDDANLDPRETFFIDDSEAN
CQGAQALGISTYTVKPGEDWRPLFAEN
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaaaggaattaaaaaccttatttttgattttggtggtgtattgattaatctc
gaccgtcagcgttgtatagaaaacttccggaagttgggattagagaaggtggacgaattg
ttaggcatgtattctcagcagggaatctttatgcaacatgagaaagggttgatctcgtca
gcccagtttcgtgatagtatccgcgggcagataactcaggaggtgacggatgagcaaatt
gatgctgcttggaatagtttcttggtggatattccacgttttaagcttgatatgttattg
aaactccgcgagaaatatgtggtctatctgctgagcaataccaacgagatacattggaag
tgggcatgtgagcatgcgtttccgtatcggggtttccgtgtagaagactattttgaaaag
atgtacctctcgtatgaaatgaaaatggtaaagcccgctgaagagattttccggggagtg
cttgatgatgcaaacctcgatccgcgcgaaacttttttcatagatgactccgaagccaac
tgccagggcgcccaggcattgggcatctctacctatacagtgaaacccggtgaagactgg
aggccgctttttgccgagaattaa

DBGET integrated database retrieval system