KEGG   Bacillus freudenreichii: NCTC4823_02358
Entry
NCTC4823_02358    CDS       T06767                                 

Gene name
ndhL
Definition
(GenBank) xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
bfd  Bacillus freudenreichii
Pathway
bfd00230  Purine metabolism
bfd01100  Metabolic pathways
bfd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NCTC4823_02358 (ndhL)
Enzymes [BR:bfd01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     NCTC4823_02358 (ndhL)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: VEF48283
UniProt: A0A3S4QAB8
Position
1:complement(2389178..2391514)
AA seq 778 aa
MSQQMEDVQKSGTGEGLKWVGKAVKRIDGPEKVTGEQKYMTDYHYPDMVWGKVLRAKYPF
AKIRSIDTSKAEAHPDVVCVLTHEDIPGFNGFGIVTPDQPVLCEDIVRCTGDAVALVAAE
TLEAAEEAIGLIEVDYDPLEAVTDAEAAMVQGAPQLHPDGNIHSHVVIKNGDIDKGFEEA
DFIFENTFYSPRQMHAFLETEGGWGKVEEDGSLTIQCPGQYGHRDKLQIARALALNPERI
HIHSSPNGGGFGGKDEITVQIYLALLALNTNRRPVKLHLSREESVVAGIKRHPFKVTVKT
GAKKDGTLVAHKVRAVGDTGAYASLGGAVVALAIEHAAGPYKIPNVDMEGFCVYTNNGIA
GAFRGFGVNQVCVGIETHIDMLAKKTGLDPIEIRKKNAYRQGEVSSLGHVVKSSVGTIQT
LERAEECDLWVNRDLHKSQASEPWKKRGVALATSFHAIGMGLRTPDYGAASIELMPDGKF
KVGLAIEEIGTGNGTVYAQVAAECLKCDIDNIIVLQGDTRETLDSGTISASRSTYTGGRA
IATAAPNMIGLLSETAAEILGVSADQIEVSENKLIIAGNTERFVSYKEIYEVLKDKNQST
RVEGHFYFPREKRELKNSGGAPHHLYGYMTHVVLVEVDTLTGETDVLKVVAIPDVGKVLN
PQGLEGQTEGGAIMGIGYTLYEDVIMKDGYHQTRNLTDYIIPTIRETPVIETIPVESMEA
SGPFGAKGIAEVVMIPIIPAIMNAIYDAVGVRIKKLPAKPEQIFQALQESKSQELVSG
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgagccaacaaatggaagatgtccaaaaatccggaacaggagaggggttaaaatgggtc
gggaaggcggtcaaaaggattgacggtcctgaaaaagtgaccggtgaacagaaatatatg
actgattaccattacccggacatggtttggggtaaagtgctgcgggccaaataccccttt
gcaaaaatcagatcgatcgacacgtccaaggcggaggcgcatccagatgtcgtctgtgtt
ttaacacatgaagatatccctggattcaacgggtttggtatcgtcactcctgaccagccc
gtattatgtgaagatattgtcaggtgtacaggggatgctgttgctcttgtagctgcagaa
acactagaagctgcagaagaagcgatcggcttaatcgaggtggattacgatccgctggaa
gctgtaacagacgcggaagctgccatggttcaaggggcgccgcaactacatccggatgga
aatatacacagccatgtggtgattaaaaacggcgacattgacaaaggctttgaggaagcg
gacttcatatttgaaaatacgttttattcaccaagacagatgcatgcattccttgagact
gaaggaggatgggggaaagttgaggaagacgggtccttgaccatccaatgtccgggccag
tacggtcaccgggataagctccaaattgctcgagcgcttgcattaaaccccgagcgcatc
catatccattccagtccaaacggagggggcttcggagggaaagacgagatcactgtgcag
atctacctggccctattggctttaaatacgaacagaagaccagtaaagcttcacctttcc
cgggaagaatctgttgtggccgggatcaagcgccacccttttaaagtgacggtgaaaacc
ggagctaaaaaagacggtacattagtggctcataaagtacgcgcagtaggagatacggga
gcatacgcttcattgggtggagcggttgtcgcattggccatcgaacatgcggcaggcccg
tataaaatacctaatgttgatatggaaggtttttgcgtatatacaaataacggaattgca
ggtgcatttagaggctttggcgtcaatcaggtctgtgtcggcattgagacgcatattgat
atgctggcgaaaaaaacagggctcgatccgattgaaataaggaaaaaaaatgcttaccgc
cagggggaggtgtcaagccttggccatgtcgtgaagtcaagtgtcggcaccatccaaacc
cttgaaagggccgaagagtgcgatctttgggtcaaccgggatcttcataaatcacaggca
agcgaaccttggaagaaacgcggtgtggcattggccacttcctttcacgccattgggatg
ggcctgcggacaccggattatggagcggcttcgattgaattaatgccagacggcaaattt
aaagtggggttggccatagaagagatcgggaccggaaatggaacggtatatgcgcaggtg
gcggccgaatgtttaaaatgcgatattgataacattattgtcttacaaggtgatacaagg
gaaacgctcgatagcggaacgatatccgcttcgcgttcaacgtataccggcggccgcgca
atagcgactgccgcacccaatatgatcggcctgctatctgaaacggcagcagaaatactt
ggtgtttcagcagaccaaattgaagtttcagagaataaattaattatagccggcaataca
gagcgttttgtttcgtataaggagatatatgaagtgttgaaggataaaaatcaatccact
cgtgtcgaaggccacttctattttccacgcgaaaaaagagaattgaaaaattccggcggg
gcaccacatcatctgtatggctatatgacgcatgtcgtgttggttgaagtggatacattg
acgggagaaaccgatgttttgaaagtcgttgctattccggatgttggtaaagtattgaat
cctcaaggattggaagggcagaccgaaggcggagctatcatggggatcggatatacattg
tatgaagatgtcatcatgaaagacggctatcatcaaacaaggaacctgacagattatatt
atcccgaccatacgggaaactcctgtgattgaaacgattccggtcgaatcaatggaggcc
tccggcccatttggcgccaaagggatagcggaagtggtcatgattccaatcattcctgct
attatgaatgccatctatgacgcagtgggagtcagaattaaaaaattacccgctaaaccg
gaacagatttttcaagccttacaggagtcgaagtcacaagaactcgtttcggggtga

DBGET integrated database retrieval system