KEGG   Bacteroides fragilis 638R: BF638R_1636Help
Entry
BF638R_1636       CDS       T01691                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00020  Citrate cycle (TCA cycle)
bfg00310  Lysine degradation
bfg01100  Metabolic pathways
bfg01110  Biosynthesis of secondary metabolites
bfg01120  Microbial metabolism in diverse environments
bfg01130  Biosynthesis of antibiotics
bfg01200  Carbon metabolism
Module
bfg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bfg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BF638R_1636
  Amino acid metabolism
   00310 Lysine degradation
    BF638R_1636
Enzymes [BR:bfg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BF638R_1636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: CBW22164
UniProt: E1WTU1
Position
1911832..1913199
Genome map
AA seq 455 aa AA seqDB search
MARFEIKMPKLGESITEGTILSWSVQVGDVVNEDDVLFEVNTAKVSAEIPSPVAGKVVEI
LFKEGDTVPVGTVVAIVDMDGEGSGEASETAGSVETASAPKAAEVSGTASVPKVQAEVAA
PKVERWYSPAVLQLAREAKISQEELDSIPGTGYEGRLSKKDIRTYIETKKGAPAADVSTT
VVSTVSANNSGSSPVPSAEVQKKAAAAAPQAQHGQSASAVSSDASVEVKEMDRVRRIIAD
HMVMSKKVSPHVTNVVEVDVTRLVRWREKTKDAFFRREGVKLTYMPAIAEATAQALAAYP
QVNVSVDGYNILYKKHINVGIAVSQDDGNLIVPVVHDADRLNLNGLAVAIDSLAKKARVN
KLMPDDIDGGTFTITNFGTFKMLFGTPIINQPQVAILGVGVIEKKPAVVETPEGDVIAIR
HKMYLSLSYDHRVVDGSLGGNFLHFIADYLENWKE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcaagattcgaaataaaaatgcccaagttgggcgaaagtattaccgaaggaaccatt
ttatcatggtcggtgcaggtaggtgacgtggtcaatgaggacgacgtacttttcgaggtg
aatactgctaaggtcagtgcggagatcccttctcccgttgccggaaaagtggtggaaata
ttgtttaaagaaggcgatacggtaccggtaggtacggtagttgccattgtagatatggat
ggagaaggttccggagaagcatcggaaaccgcaggctctgtagaaacggcgtctgctcca
aaggctgccgaggtgtcgggcactgcgtctgttccgaaagttcaggcggaagtagccgct
cccaaagtggaacgttggtattcgccggcagtacttcaattggcacgggaggcgaagatt
tctcaggaagaactggattcgattcccgggacaggttatgaaggccggctgagcaaaaaa
gatatccgcacttacatcgagacgaagaaaggtgctccggcagccgacgtctctactacg
gtggtttcgacggtttcggcaaataattcgggctcttctcctgttccttctgcagaagta
caaaagaaggctgccgctgcggctcctcaggctcagcatggacaatctgcttctgccgtt
tcttcagatgcatcggtagaagtcaaagagatggatcgagtacgtcgcatcattgccgac
catatggtgatgtcgaaaaaggtttctccgcatgtgactaatgtggtcgaagtagatgtc
acccggctggtgcgttggcgcgaaaagaccaaagatgctttcttccgtcgtgaaggtgtg
aagctgacttatatgcctgccattgctgaggccactgcccaggcgttggctgcctatcct
caggtaaatgtctcggtggacggatacaacatcctgtataagaaacatatcaatgtgggc
attgctgtttcgcaagatgatggaaacttgattgttcccgtagtgcatgatgccgatcgt
ttgaatcttaacggacttgccgtagctatcgattcgttggcgaaaaaggcacgggttaat
aagctgatgcctgatgatatcgacggaggaacattcacaatcaccaatttcggtacgttt
aagatgttgttcggcactccgatcatcaatcagccacaggtggctattctcggagtgggt
gtcattgagaaaaagccggctgtggtggagactcccgaaggagatgtgatagccattcgc
cataagatgtacttgtcactctcttatgatcaccgtgtggtggatggttcgctgggaggt
aacttcctgcacttcattgccgactatctggagaactggaaagaatag

DBGET integrated database retrieval system