KEGG   Bacteroides fragilis 638R: BF638R_1750Help
Entry
BF638R_1750       CDS       T01691                                 

Definition
(GenBank) putative transcriptional repressor
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00010  Glycolysis / Gluconeogenesis
bfg00052  Galactose metabolism
bfg00500  Starch and sucrose metabolism
bfg00520  Amino sugar and nucleotide sugar metabolism
bfg00521  Streptomycin biosynthesis
bfg00524  Neomycin, kanamycin and gentamicin biosynthesis
bfg01100  Metabolic pathways
bfg01110  Biosynthesis of secondary metabolites
bfg01120  Microbial metabolism in diverse environments
bfg01130  Biosynthesis of antibiotics
bfg01200  Carbon metabolism
Module
bfg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF638R_1750
   00052 Galactose metabolism
    BF638R_1750
   00500 Starch and sucrose metabolism
    BF638R_1750
   00520 Amino sugar and nucleotide sugar metabolism
    BF638R_1750
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BF638R_1750
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BF638R_1750
Enzymes [BR:bfg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BF638R_1750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK MreB_Mbl
Motif
Other DBs
NCBI-ProteinID: CBW22276
UniProt: E1WUC4
Position
2060956..2061813
Genome map
AA seq 285 aa AA seqDB search
MKLSIDLGGTNVRIAQVENGICLNKMSVPCLAQQDASAVLDQLFQLITGMMNVQVDGIGI
GVPSIVDVEKGIVYNVANISSWKKIHLKDILEKRFMVPVAINNDSNCFTLGESMFGEGKP
YAHMVGVTIGTGIGAGVIINHRLYCGQYMGAGEIGSLPYLDSDFEHYCSSSFFKRHDTTG
VVVAEKAERGDGAALEIWREFGTHLGNLMKVILFSYAPQAIILGGSIVSAFHFFKDTMKD
AMQDFPYKILLDNVKIITSYLKDASLLGASALFEKQYLPISIINN
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtcaattgatttaggaggaacaaatgttcgaattgcccaagtggagaatggt
atctgtttgaacaagatgtctgtaccttgtcttgcgcaacaagatgcttcagcggtactt
gatcagctttttcaacttattacgggtatgatgaacgtccaggtggatggtattggtatc
ggtgtcccttcaattgtagatgtggaaaaaggtatcgtgtataatgtggcgaatatatct
tcttggaaaaaaatacatttgaaagatatattggaaaagcgatttatggtgccggttgct
attaacaatgactctaattgtttcactttaggcgaaagtatgttcggcgaggggaagcct
tatgcccatatggtgggagttactattgggacaggtataggtgcgggtgttatcattaat
catcggttgtattgtggtcaatatatgggggccggtgaaataggctcgcttccttatctg
gattctgattttgaacattattgcagtagttctttctttaagcgacatgacacgacaggt
gtagtggtagccgaaaaagcagaacggggagatggggctgcgctggaaatctggagggaa
tttgggacgcatctgggtaatttgatgaaagtaattctcttttcttatgctcctcaagct
attattttgggcggaagtatagtatcggcttttcacttttttaaggatactatgaaggac
gctatgcaagatttcccttataaaatactattggacaatgtgaaaataattacttcatat
ttgaaggatgctagcttattaggagcttccgctttgtttgagaaacaatatttaccaata
tctattataaacaattaa

DBGET integrated database retrieval system