KEGG   Bacteroides fragilis 638R: BF638R_1853Help
Entry
BF638R_1853       CDS       T01691                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00010  Glycolysis / Gluconeogenesis
bfg00030  Pentose phosphate pathway
bfg00051  Fructose and mannose metabolism
bfg00680  Methane metabolism
bfg01100  Metabolic pathways
bfg01110  Biosynthesis of secondary metabolites
bfg01120  Microbial metabolism in diverse environments
bfg01130  Biosynthesis of antibiotics
bfg01200  Carbon metabolism
Module
bfg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bfg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF638R_1853
   00030 Pentose phosphate pathway
    BF638R_1853
   00051 Fructose and mannose metabolism
    BF638R_1853
  Energy metabolism
   00680 Methane metabolism
    BF638R_1853
Enzymes [BR:bfg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BF638R_1853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: CBW22377
UniProt: E1WUW8
Position
2192072..2194066
Genome map
AA seq 664 aa AA seqDB search
MTAQSNITPESIVADLRYLQLLSRSFPTIAAASTEIINLEAILNLPKGTEHFLTDIHGEY
EAFQHVLKNASGAVKRKVNEIFGHTLREIEKKELCTLIYYPEEKLQLIKATETDIDDWYL
ITLNQLVKVCQNVSSKYTRSKVRKSLPAEFSYIIQELLHESTIEPNKHAYINVIISTIIS
TRRADDFIIAMCNLIQRLTIDSLHIVGDIYDRGPGAHIIMDTLCDYHNFDIQWGNHDILW
MGAASGNEACMANVIRLSMRYGNLGTLEDGYGINLLPLATFAMDTYADDPCTIFAPKTNF
ADSTYNEKTLRLITQMHKAITIIQFKLEANIINRRPEFGMGGRKLLEKIDFERGVFVYEG
KEYPLRDTNFPTVDPADPYRLTDEEQELIEKIHYSFMNSEKLKKHMRCLFTYGGMYLVCN
SNLLYHASVPLNEDGSFKHVNICGKEYWGKNLLDKIDQLIRTAYFDEDDEEEKRFAMDYI
WYLWCGPDAPSFDKDKMATFERYFIADKSLHKETKGYYYALRNKEEICDRILEEFGVTGQ
HTHIINGHVPVKTIKGEQPMKAGGKLLVIDGGFSKAYQPETGIAGYTLVYHSHGLQLVQH
DPFQSTQKAIEEGQDIKSTTFVIEFNSQRMMVKDTDKGKELVTQILDLKKLLVAYRIGLI
KEKV
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcaaagtaatataacccccgaaagtatcgttgccgatctgcgttatctgcaa
ctgctttcacgtagtttccctaccattgccgctgccagtacagagattatcaatcttgaa
gccatcctgaatcttccgaaagggaccgaacactttctgaccgatatacatggcgagtat
gaagcttttcagcatgtattgaaaaatgcttcgggagcggtgaagcggaaagtgaacgaa
atattcggccatactctccgtgagatcgagaagaaagaactctgtacgcttatttattat
ccggaagagaaactccaattgattaaagcaaccgaaaccgatatcgacgattggtacctg
atcactctcaatcagctggtaaaggtctgccagaacgtatcatccaaatatacccgttcg
aaggttcgcaaatcattgccggccgagttctcctatatcatccaggagttacttcacgaa
tcgaccatcgagcccaataaacatgcttatatcaatgtgattatcagtaccattatttcc
actcgccgcgctgacgactttatcattgccatgtgtaatctgatacagcgtcttacgatc
gattcactccatatcgtgggcgatatctacgatcgtggtccgggtgcccatatcataatg
gatactttgtgtgattatcacaatttcgatatccaatggggaaatcacgatatcctctgg
atgggtgcagcatcgggtaatgaagcttgtatggccaacgtgatccgtctctcgatgcgt
tacggcaatctggggacattggaagatgggtatggcatcaatcttttgcctcttgccact
tttgcgatggatacttatgcggatgatccctgtaccatctttgcacctaagaccaacttt
gccgattctacttataacgagaagaccttgaggctgataacccagatgcataaagctatt
accatcattcagtttaagctggaggcaaacattattaatcgtcgtccggagttcggaatg
ggtggtcgcaagttgcttgagaaaatcgactttgaacggggagtatttgtctatgaaggc
aaagaatatccgttgcgcgataccaacttccctacggtagatcctgcagatccttatcgt
ctgactgatgaagagcaggaattgatagaaaagatacattactcgtttatgaacagcgag
aaactcaaaaaacacatgcgttgcctctttacctatggaggtatgtatctggtgtgcaat
tccaatttgctttatcatgcctctgtgcctctcaacgaggatggaagtttcaagcacgtg
aatatctgcggtaaagagtattgggggaagaacttgctggacaagatagaccaattgatt
cgtacggcttattttgatgaagatgatgaagaagagaaacgctttgccatggattacatc
tggtatctgtggtgcggaccggatgccccttcgttcgacaaagacaagatggctacgttc
gaacgttatttcattgcggataagagcctgcataaagagacgaaaggatattattatgct
ttgcgtaacaaagaagaaatctgtgaccggattcttgaagaattcggagtgacagggcag
catactcatatcatcaacggtcatgtgccggtaaagaccattaaaggagagcagccgatg
aaagccggtggaaaattgttggtcatcgacggtggtttttcgaaagcttatcagccggag
accggtattgccggatatacgctggtatatcattcacatggtttgcagttggtgcagcat
gaccctttccagtctacacagaaagccatcgaagagggacaggacattaagtcgactacc
ttcgtcatcgagttcaattcacaacgaatgatggtgaaagataccgataagggaaaagag
ctcgtaacgcaaattctggatttaaagaagttgttggtagcataccggatcggtttgata
aaggagaaggtctga

DBGET integrated database retrieval system