KEGG   Bacteroides fragilis 638R: BF638R_1982
Entry
BF638R_1982       CDS       T01691                                 

Definition
(GenBank) hypothetical protein
Organism
bfg  Bacteroides fragilis 638R
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: CBW22504
UniProt: E1WVT9
Position
complement(2341611..2343428)
AA seq 605 aa
MANLFTKESIKARMFKQAATLYDIRNIDGIDPLIRLLIEALSGEIFKLSGDVHAIESRLL
EKVASALTPHTALVARPAHAIAAARSYSPQAIVSPTDLFAYKSTEIVKKYKMKNLFFTPL
HETRIINAELKYLVTADEFCTISPEGERDAIAHLHSGVPVMGRKISIGMKIGSNVTTLND
LPLYIDIPHVADKSSYLKLLPYCHCTIAGIPIEIKGGIEYDSARSVSEKYDLGRLITEEI
TSKYAPHYLTLKAPGLKVRDLSRSRVPEEISSLLPGDFIAGCDADTVWIDIEFPTAFSKE
VLEQVKVQMNTFIVVNKYPAKITRKVDSVSAILPLEKTEFEYFLFVDSITDNHGDQLREI
SSTQDESRAGCYSVRRGGCERFNAMDAKDFLNRLTDLLYDESVAFSSTDKDGMKEVIEQI
EERVNQLGDKNKDGVGGQEMLSYVVIDQRYDKDTRLTVDYTLTNGEFANDIYAGEPLNDC
ANPDIDKDTLRFVTSVHGGKPSPSVKRRMDMYRFMLLSHGSIYTKEDIRNFCMARYGDSI
RSVEVKLGYAAGKKESEGFIRTLDVYLRLSEGMQGLDKEEFVVELDSELRRLSPETYNYR
VFINS
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggcaaatctattcacaaaagaaagcattaaagcccggatgttcaaacaggcggcaacc
ctatatgacatacgaaatatagatggtatagaccctcttatccgactgctgattgaagcc
ttgtcgggtgaaatcttcaagctgtccggtgatgtgcacgccattgaaagccgtttgttg
gagaaagtcgcttccgcccttactccccacacagcattggttgcccgccccgcccatgcc
attgctgccgcccggtcgtactccccgcaagccattgtgtcccctacagacctgtttgct
tataaaagcacggagattgtgaagaagtataaaatgaaaaatctcttctttactccgctg
catgaaacccgcataatcaatgccgaattgaaatatctcgttacggcggatgaattttgc
acaatcagtcccgaaggagagcgtgacgccattgcgcaccttcactccggcgtaccggtg
atggggcggaaaatcagcatcgggatgaagattggcagcaatgtaactactctcaacgac
ttgccattatacatagatataccacatgtagcggataagagcagctatctgaaattactg
ccgtactgccattgcacgattgccggtatccctatagaaattaaaggaggaatcgagtac
gactccgcacgttcggtcagtgagaaatacgaccttggcaggctgattacggaagaaata
accagcaaatatgctccccactacctgacattgaaagctcccggattaaaagtcagagat
ttgtcacgtagcagagtgcccgaagaaatctcttccctgctgccaggtgatttcattgcc
ggatgtgatgcggacaccgtgtggatagatatagaatttcccaccgctttttcaaaagaa
gtactggaacaggtaaaggtgcagatgaacactttcatcgtagtaaacaaatatccggca
aagattaccagaaaggtggattccgtctctgccattctccctttggaaaagacggaattt
gaatatttcctgtttgtggattcgattaccgataaccacggagaccaacttagggaaatt
tccagcacacaggatgaaagtagagccggctgttattcggtcagaaggggcggttgcgaa
cgcttcaatgcgatggacgccaaagattttctgaaccgtctgacagacctgctatatgac
gaaagcgtggctttctcttcgacagacaaagacgggatgaaagaggtgatcgagcagata
gaggaacgggtaaaccaattgggagataagaataaagacggagtcggaggacaggaaatg
ctgtcgtatgtagtcatagaccaacgttatgacaaggatacccggttaactgtggattat
actcttactaatggcgaatttgccaatgacatctatgcgggagaaccgttgaatgactgc
gcaaatcccgatatagacaaagatacgctgcggtttgtcacttccgttcatggaggaaag
ccttccccatccgtaaagcgccggatggatatgtaccgattcatgctgttgtcacacggc
agcatatacacaaaagaggatatacgcaatttctgcatggcaaggtatggcgacagcatc
cgctctgtggaggtaaagctcgggtatgcagccggtaaaaaagaaagcgaaggtttcata
aggacgctggacgtgtatctacggttatcggaggggatgcaaggattagacaaggaagag
ttcgttgtcgaattggacagtgagctcaggcggttgtctccggagacctataactaccgt
gtttttattaactcatag

DBGET integrated database retrieval system