KEGG   Bacteroides fragilis 638R: BF638R_4228Help
Entry
BF638R_4228       CDS       T01691                                 

Definition
(GenBank) putative haloacid dehalogenase-type hydrolase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
bfg  Bacteroides fragilis 638R
Pathway
bfg00010  Glycolysis / Gluconeogenesis
bfg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF638R_4228
Enzymes [BR:bfg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     BF638R_4228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase NIF IL4_i_Ig
Motif
Other DBs
NCBI-ProteinID: CBW24651
UniProt: E1WQ31
Position
complement(4967264..4967887)
Genome map
AA seq 207 aa AA seqDB search
MKRKGIKNLIFDFGGVLINLDRQRCIENFRKLGLEKVDELLGMYSQQGIFMQHEKGLISS
AQFRDSIRGQITQEVTDEQIDAAWNSFLVDIPRFKLDMLLKLREKYVVYLLSNTNEIHWK
WACEHAFPYRGFRVEDYFEKMYLSYEMKMVKPAEEIFRGVLDDANLDPRETFFIDDSEAN
CQGAQALGISTYTVKPGEDWRPLFAEN
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaaaggaattaaaaaccttatttttgattttggtggtgtattgattaatctc
gaccgtcagcgttgtatagaaaacttccggaagttgggattagagaaggtggacgaattg
ttaggcatgtattctcagcagggaatctttatgcaacatgagaaagggttgatctcgtca
gcccagtttcgtgatagtatccgcgggcagataacccaggaggtgacggatgagcaaatt
gatgctgcttggaatagtttcttggtggatatcccacgttttaagcttgatatgttattg
aaactccgcgagaaatatgtggtttatctgctgagcaataccaacgagatacattggaag
tgggcatgtgagcatgcgtttccgtatcggggcttccgtgtagaagactattttgaaaag
atgtacctctcgtatgaaatgaaaatggtaaagcccgctgaagagattttccggggagtg
cttgatgatgcaaacctcgatccgcgcgaaacttttttcatagatgactccgaagccaac
tgccagggcgcccaggcattgggcatctctacctatacagtgaaacccggtgaagactgg
aggccgctttttgccgagaattaa

DBGET integrated database retrieval system