KEGG   Butyrivibrio fibrisolvens: CIY_11230Help
Entry
CIY_11230         CDS       T02581                                 

Definition
(GenBank) Arabinogalactan endo-1,4-beta-galactosidase
  KO
K01224  arabinogalactan endo-1,4-beta-galactosidase [EC:3.2.1.89]
Organism
bfi  Butyrivibrio fibrisolvens
Brite
KEGG Orthology (KO) [BR:bfi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CIY_11230
Enzymes [BR:bfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.89  arabinogalactan endo-beta-1,4-galactanase
     CIY_11230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_53 Big_4 Cellulase CBM_4_9
Motif
Other DBs
NCBI-ProteinID: CBK73963
UniProt: D4J1H4
Position
1041899..1044715
Genome map
AA seq 938 aa AA seqDB search
MGRLKKGFFAKPASVGLAAATVLCQVGVAIPAKAEEEKSWKETSLIENGDFETGDLSGWT
VEMPEDDGDSAGCKIKVDQWASNNKTNIFNYWNNKEEAVSLELSQTVDAVPAGTYKLSFE
ADGAESEAGVSVSINGESVSIKTTGWDSWSTFTTEEFTLEEEEDLTVALSGDVASGYWGD
VDNFVLYSFKESSDDDEKDDDNKDEEEDNKIEADINVEKVPGCDANFITGVDVSSYLSEK
NSGVKFYDFDGNELSNQGFFEFLKDCGVNYVRLRVWNDPTDENGNGYGGGNCDIDSAVKM
GRWISNAGMKVLIDFHYSDFWADPGKQTAPKSWAGMTVEEKAKACQKFTSESLQKLLDAG
VDVGMVQVGNETNNGVAGEKSWANMAKIFSAGSKAVRTVAEKNDKDILVAVHFTNPETSG
RYEGYAANLEKYEVDYDVFASSYYPYWHGTLANLKNVLSNIADKYNKKVMVAETSYVHTL
EDGDGHTNTEYEGKSGDALNYDISVQGQADSVRSVISTVASIDNGIGVFYWEPAWIPVNV
YDKDAENAEEILASNKEAWEKYGSGWASSYSGKYDKDARDWFGGSAVDNEAWFDFEGHAL
PSAKIYSYVRTGASAPLSVLRIDVEDVTFELGDEVKLPENAKVVYNDGSEIEVAITWDAE
ALASAVNSGAGEYTIKGTVTVLDKEEEVACKLTINPRNLLANPGFEDGNTVWNIKDDGNT
DEKNGVAIQADSSNVRTGTMSLKFWDNESIDFTVEQEVTLDKGIYKLGAYVEGGDCGENA
DFKLYAKVGEHSFETPTGVTGWQNWANPQVEEIKVNADGTTVKVGVSVKAIAGGWGAWDD
FYLYRTGDVSEEVEPGKEDDNGEVENPSENNDEPTPTVTPTPEDKPKEDEKVDPAKEAQV
VIEQVVKCVKKVVEVIKPVIKPIIKVVTNILKKLFGWW
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgggaagattgaaaaaagggttttttgcaaagcctgcaagtgtaggacttgcagcagca
actgtcttgtgccaggttggtgtggctattcctgcaaaagctgaggaagagaaaagctgg
aaagagacaagccttattgaaaatggcgattttgaaacaggtgatttatcgggatggact
gttgaaatgccagaagatgatggagacagtgcaggctgtaaaatcaaagttgatcagtgg
gcaagcaacaacaaaacaaacatatttaactactggaacaacaaggaagaagctgtttca
cttgagctttcgcagactgtagatgcagttccagcaggtacctacaagctttcttttgaa
gcagatggtgctgaaagtgaagcaggtgtctcagtatctattaatggtgagagtgtttca
attaagactaccggctgggatagctggtctacttttacaacagaagagtttactttggaa
gaagaggaggatttaactgttgctctaagtggagatgtagcttcaggttattggggagat
gttgataacttcgtactctattccttcaaggaatcatcagatgacgacgaaaaggatgat
gataataaagatgaggaagaggataacaagatagaagctgatattaacgtagagaaggta
ccaggctgtgatgcaaactttatcacaggtgtcgatgtgagctcatatctttctgagaaa
aacagtggtgttaaattctacgatttcgatggaaatgagcttagtaatcaagggttcttt
gagtttttaaaggattgcggagttaactacgtcagactcagagtatggaacgatccaaca
gatgaaaatggtaatggttatggcggtggaaactgcgatatcgattcagcggtaaaaatg
ggaagatggatttctaatgctggaatgaaggtactcattgatttccattattcggatttc
tgggctgatccaggaaaacagactgcaccaaagtcatgggctggaatgactgtagaggag
aaggctaaggcttgtcagaaattcacatcagaaagtctgcagaagcttctggacgcaggt
gttgatgtaggaatggttcaggttggtaatgaaaccaataatggagtggcaggagaaaag
tcatgggctaatatggctaaaatcttttctgcaggaagtaaagctgttagaactgtagca
gagaagaatgataaggatatcttagtagccgttcactttacaaacccagagacaagcggc
agatatgaaggctatgcagccaatcttgaaaaatatgaagtagattatgatgttttcgca
tcttcatattatccatattggcatggaacacttgcaaatctgaaaaatgttctttctaat
atagcagataaatacaataagaaggtaatggttgcagaaacttcttatgtacatacctta
gaggatggcgatggtcataccaatactgaatatgagggaaaaagcggagatgctttaaat
tatgacatctcagttcagggacaggcagattctgttcgcagtgtcattagcactgtagct
tcaattgataatggcattggtgttttctactgggagccagcatggattccagtaaatgta
tatgacaaggatgcggaaaatgctgaggaaatacttgcatcaaacaaggaagcttgggag
aaatatggctcaggctgggcatcatcttattccggaaaatacgataaggatgccagagat
tggtttggaggttcagcagtagataacgaagcatggtttgatttcgagggacacgccctt
ccatcagctaagatttacagttatgtaagaacaggtgcatctgcgccattatcggtttta
cgaattgatgttgaggatgttacattcgaacttggagatgaagtaaagcttccagagaat
gccaaggtagtatataacgatggttctgaaatagaagtagccattacttgggatgcagaa
gctcttgcatcagcagtaaatagcggagcaggtgaatatacaattaaaggaacagtaaca
gtccttgataaagaggaagaagttgcctgcaagcttacaatcaatcctagaaatcttctt
gctaacccaggttttgaggatggcaacacagtatggaacatcaaggatgatggaaatact
gatgaaaaaaatggcgtggctattcaggctgattcatcaaatgttagaactggaacaatg
agcttgaagttctgggataatgagagtattgatttcacagtagagcaggaggttacctta
gataaaggaatctacaagcttggtgcctatgtagaaggtggagattgcggtgaaaatgca
gactttaagctttatgccaaagttggagagcatagctttgagactccaacaggtgtaaca
ggatggcagaattgggctaatccacaggtagaggaaataaaggttaatgcagatggaact
actgtaaaagtaggtgtttcggtaaaggctatagctggaggctggggcgcatgggatgat
ttttatctctatcgtacaggtgatgtttctgaggaagtagagcctgggaaggaggatgac
aacggtgaagtagaaaatccttcagagaataatgatgaaccaactcctacagttacacca
actcctgaggataaacctaaggaggatgaaaaggttgaccctgctaaagaggctcaggtg
gtaattgaacaggttgtaaaatgtgttaagaaagtagttgaggtaataaagccagtaatc
aagcctatcataaaggttgtaacaaacatccttaagaagctatttggctggtggtaa

DBGET integrated database retrieval system