KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl074Help
Entry
Bfl074            CDS       T00138                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
bfl00564  Glycerophospholipid metabolism
bfl01100  Metabolic pathways
bfl01110  Biosynthesis of secondary metabolites
Module
bfl_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bfl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bfl074 (psd)
Enzymes [BR:bfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Bfl074 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CAD83598
UniProt: Q7VQP8
Position
complement(80515..81411)
Genome map
AA seq 298 aa AA seqDB search
MLEKIQVILQYLLPIRWITYLAGLGASWKGGWITRYIILLFIRIYKINLQECIDPNINNY
KTFNEFFMRKFNINTRSIDKNPSTLIIPADGIISQIGKINNTHIFQIKNSSYYLDQLLAG
HDNIINYFRNGSFVIIYIPPQNCHWVYMPCTGTLRELLYIPGDLFSVHPKIIKNIPDVLS
RNEKLICLFDTQFGYMAQILVGSAIVGSIETVWCGTITPPRTGLVKHWHYPKSYNNNITT
KSTERNAVILSKAAEMGVFKFGSTVINLFSNDTVLLNEKLQLNNIVKIGMTLAHGKIN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaaaaatacaagttatattacaatacttattacctatcagatggattacttac
ttagcaggtttaggagcttcatggaaaggaggatggataactcgttatattattttatta
ttcattcgtatttataaaatcaatcttcaagagtgtattgatccaaatataaataattac
aaaaccttcaacgaattctttatgagaaaatttaacattaatactcgatctattgataaa
aatccatctactttaattatacctgcagatggtattatttctcaaataggtaaaattaat
aatacgcatatttttcaaattaaaaattcctcttattatttggatcaattacttgcaggt
catgacaatattataaactattttagaaatggcagttttgtaattatctatataccacct
caaaattgccattgggtttatatgccatgtacaggaacattacgtgaattattgtatata
cctggagatttattttcagtacacccaaaaataattaaaaatatccctgatgtgttatct
cgcaacgaaaaactcatttgtttatttgacacgcaatttggatatatggcacaaatttta
gtaggatctgctatagtaggaagtattgaaactgtttggtgcggaacaattacacctcct
cgaacgggattagttaaacactggcattatcctaaatcttataataataacattaccacc
aaaagtactgaacgtaacgctgttatattatctaaagctgcagaaatgggagtattcaaa
tttggatcaactgtcattaacttatttagtaatgatacagtccttttaaacgaaaaatta
caactaaataatatagttaaaattggaatgactcttgctcacggaaaaatcaattaa

DBGET integrated database retrieval system