KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl146Help
Entry
Bfl146            CDS       T00138                                 

Gene name
ftsZ
Definition
(GenBank) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Brite
KEGG Orthology (KO) [BR:bfl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bfl03036]
    Bfl146 (ftsZ)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bfl04812]
    Bfl146 (ftsZ)
   02048 Prokaryotic Defense System [BR:bfl02048]
    Bfl146 (ftsZ)
Chromosome and associated proteins [BR:bfl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Bfl146 (ftsZ)
Cytoskeleton proteins [BR:bfl04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   Bfl146 (ftsZ)
Prokaryotic defense system [BR:bfl02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Bfl146 (ftsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C NAD_binding_10 HCMVantigenic_N
Motif
Other DBs
NCBI-ProteinID: CAD83667
UniProt: Q7VQI4
Position
168893..170068
Genome map
AA seq 391 aa AA seqDB search
MFEPIELTSDAVIKVIGIGGGGSNAVEHMLRERIEGVDFFAVNTDAQALRKMIVGQTIQI
GSSITKGLGAGSNPEIGRNSAEEDRDVLRSTIEGADMVFIAAGMGGGTGTGAAPVVAEVA
KDLGILTVAVVTKPFNFEGKKRMMFAEQGITELSKYVDSLITIPNDKLLKVLGRGISLLD
AFSAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVGCGDDRAEEAS
ELAIASPLLEDIDLSGARGVLVNITSGLDLRLDEFETVGNTIRSFASDNATVVIGTALDP
DIKNDELRVTVVATGIGVDKNLENTLPTADHLEEQKMVKESHYNNHAIQKQRKSAFFNES
QHDTSSNVVSHDNSILDKDMDYLDIPAFLRK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaccaatagagttaactagtgatgcggtaattaaagtcattggtattggtgga
ggaggtagcaatgctgtggaacatatgttacgggaacgtattgaaggggtggattttttt
gcagtaaacactgatgctcaagctttacggaaaatgattgtaggccagactattcagatt
ggtagttctattactaaaggattaggggcaggatctaatccagaaattggtcgaaattct
gcagaagaagatcgagatgtgttgagatctacgatagaaggggctgatatggtgtttatt
gctgctggtatggggggaggtacgggaactggagcagctccagttgtagcagaagtggca
aaagatttaggaattttaacagttgctgtagttactaaaccttttaattttgaaggaaaa
aaacgtatgatgttcgctgaacaaggtattactgaattatctaaatatgtagattcatta
attactattcctaatgataagttattaaaagttttaggacgaggtatatcattacttgat
gcctttagcgcagctaatgatgtattaaaaggggcggtacagggtattgctgaattgatt
actaggcctggtttaatgaatgtggattttgcagatgtacgtactgtaatgtcagaaatg
ggatatgctatgatgggctcaggagtaggatgcggagatgatagagcggaagaggcatct
gagttagctattgctagtccattattagaagatattgatttgtctggagctcgaggggta
ttagtaaatattacttctggtttagatttaagattggatgaatttgaaacagtgggtaat
actatacggtcttttgcgtcagataatgcaactgtagtaataggaacagctttagatcct
gatataaaaaatgatgaattgagagtgacggtagttgcaacaggaattggagttgataag
aatttagaaaatacattacctactgccgatcatttagaagaacagaaaatggttaaagaa
agtcactataataatcatgcaatacagaagcaaagaaaatctgctttttttaatgaatct
caacatgatacatcatcgaatgtagtaagtcatgataattctattttagataaggacatg
gattatttagatattcctgcatttttaaggaaatga

DBGET integrated database retrieval system