KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl152Help
Entry
Bfl152            CDS       T00138                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
bfl00010  Glycolysis / Gluconeogenesis
bfl00020  Citrate cycle (TCA cycle)
bfl00620  Pyruvate metabolism
bfl01100  Metabolic pathways
bfl01110  Biosynthesis of secondary metabolites
bfl01120  Microbial metabolism in diverse environments
bfl01130  Biosynthesis of antibiotics
bfl01200  Carbon metabolism
Module
bfl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bfl152 (aceF)
   00020 Citrate cycle (TCA cycle)
    Bfl152 (aceF)
   00620 Pyruvate metabolism
    Bfl152 (aceF)
Enzymes [BR:bfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bfl152 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CAD83673
UniProt: Q7VQH8
Position
complement(178141..179418)
Genome map
AA seq 425 aa AA seqDB search
MVININVPNIGENELEVTEIFIKNGDNIDINQPLLIIEGDKSSTEIPSPYAGIITKIHVQ
VGDKVQTGTLIISLDIIKTHDLDQSIQTKQNTKNEPNINNNIIDNNTDIQKYHITSISNN
NIPTHATPFIRHMARKFDINLSHIQGSGRKGRILKEDIQKYLSNTSTKTMDYNPINKNIS
SLHPDTNFSKFGHTETIQLNKIQKISASNLQKNWSIIPHVTQFDMVDITSLEIFRKQQNF
EIKKNKLNYKITMLVFVIKAVSKALQELPQFNSSLSQDGHTLILKKYINIGIAVDTKRGL
LVPVLQNTDKKNITTLSKELLEISQKARVGKHLTPLDIQGGTFTISNLGGIGGTLFTPII
NAPEVAILGISQAIMKPVWTGKKFIPRLMLPLSLSYDHRVINGADGAKFINRINKIISDI
RLLSI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcaacattaacgtaccaaatattggtgaaaatgaattagaagttactgaaata
tttataaaaaatggagacaatattgatattaatcaacctttacttataattgaaggtgat
aaatcatctacagaaattccatcaccttatgctggcattattactaaaattcatgttcaa
gtaggagataaagttcaaacaggaaccttaattatatctttagatataattaaaactcat
gatctcgatcaatctatacaaacaaaacaaaataccaaaaatgaaccaaatattaacaat
aatatcattgataacaatacagatatacaaaaataccatattacatctatctcaaataat
aatatacctacacatgctacaccatttattcgtcatatggctcgaaaatttgacatcaac
ttatctcacattcaaggcagcggccgtaaaggacgtatacttaaagaagatattcaaaaa
tatctcagcaatacttccacaaaaactatggactataatccgatcaataaaaatatatct
tctttacatccagatacaaatttcagtaaatttggtcatactgaaactatacaattaaac
aaaatacaaaaaatttctgcttctaatctacaaaaaaattggtctatcattccacatgta
acacaattcgatatggttgatattacttctttagaaatcttccgaaaacaacaaaatttt
gaaattaaaaaaaataaacttaattacaagattacaatgttagtttttgtaatcaaagca
gtatccaaagcactacaagaattacctcaattcaatagctctttatcacaagatgggcat
acactaattttaaaaaaatacattaatatcggaattgcagtagatactaaaagaggttta
ttagtacctgttcttcaaaatacagacaaaaaaaatattactactttatctaaagagcta
ttagaaatttctcaaaaagcgcgagttggtaaacatttaactcctcttgacatacaagga
ggaacttttactatatctaatttaggaggaatcggaggtacattatttacccccattatc
aatgctccagaagtagctattttaggtatatctcaagctattatgaaaccagtatggacc
ggaaaaaaatttataccacgcctcatgttacctttatctctatcatatgatcaccgtgtt
attaatggagctgatggagctaagtttattaaccgaattaataaaataatttctgacata
cgattactatctatataa

DBGET integrated database retrieval system