KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl463Help
Entry
Bfl463            CDS       T00138                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
bfl00340  Histidine metabolism
bfl01100  Metabolic pathways
bfl01110  Biosynthesis of secondary metabolites
bfl01230  Biosynthesis of amino acids
Module
bfl_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Bfl463 (hisD)
Enzymes [BR:bfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Bfl463 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh 6PF2K
Motif
Other DBs
NCBI-ProteinID: CAD83522
UniProt: Q7VQX0
Position
510764..512077
Genome map
AA seq 437 aa AA seqDB search
MISTQYLIPTYWHRCSISEQLTLLTRPINKHNNSIHLDVKYILDHVSKLGDNALIKFNLQ
FDYVNTISLKISPNKIINSGNSLSKPIKKAIHSAIDNITRFHTAQYFPKVDLEIIPGVRC
KQIIRPLHTIGLYVPGGSTPLPSTVMMLGIPAKIAQCKRIILCSPPPIPNIILYTAQLCG
IEEIYQVGGAQAIAAMGFGTESIPRVDKIFGPGNIWVTEAKRQIHYITNKVAIDMLAGPS
EILIIADKTANPIFIAADLLSQAEHGPDSHIILITPDMNLAQQTRQELYKQIQNLDRIDI
IHQSLTHARIIITDNIMECFQISNDYAPEHLLIQTQNPENYLKYITNAGSIFLGHWSPES
AGDYASGTNHVLPTYGHATTTSALGVADFQKRILVQELTQHGLLQLSSTIQTLTKIEKLK
AHEYSVIHRINYIKGTT
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatttctactcaatatcttatacctacttattggcatcgttgttcaatatctgaacaa
ttaactctacttacacgtccaataaataagcataataatagcatacatttagatgttaaa
tacatattggatcacgtttctaaattaggagataatgccttaataaaatttaatctccaa
tttgattacgttaatacaatctctttaaaaatttcacctaacaaaattataaattcagga
aattctctatctaaaccaataaaaaaagcaatacactctgcaattgacaatattactaga
tttcacacagcacaatattttccaaaagtagatttagaaattatacccggagtcagatgt
aaacaaattattcgacctctgcataccatcggattatatgtaccaggtggatctactcca
ttaccctctacagtaatgatgttaggtatccctgcaaaaatagctcaatgtaaaagaatc
atattatgctcccctcctcctattcctaatataatattatataccgcacaactttgtggc
atcgaagaaatttatcaagtaggaggtgctcaagctattgctgctatgggattcggtaca
gaatctattccaagagttgataaaatttttggaccaggtaatatttgggttacagaagct
aaaagacaaattcattatataactaataaagtggctattgatatgttagctggtccttct
gaaatattaattattgcagataaaactgctaatccaatttttattgcagctgacctttta
tcgcaagcagaacacggaccagattcgcatatcatacttataactcctgatatgaacctt
gcacaacaaacacgacaagaactatacaaacaaatacaaaatcttgatcgcattgatata
atacatcaatcattaacacatgctcgtataatcattactgataatatcatggaatgtttt
caaatcagcaatgattatgctccagaacatttacttatacaaactcaaaaccctgaaaat
tatttaaaatatatcaccaatgcgggatcaatatttttaggacattggtctccagaatca
gctggagattatgcaagtggaactaaccatgtattacctacatatggccatgcaactacc
acttccgctttaggagttgcagattttcaaaaacgaattttagtacaagaattaactcaa
catggattattacaattatcttcaacaattcaaacactaactaaaatagaaaaattaaaa
gcacacgaatattctgtaatacatcgcataaattatattaaaggaactacatga

DBGET integrated database retrieval system