KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl466Help
Entry
Bfl466            CDS       T00138                                 

Gene name
hisH
Definition
(GenBank) glutamine amidotransferase, subunit with HisF
  KO
K02501  imidazole glycerol-phosphate synthase subunit HisH [EC:4.3.2.10]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
bfl00340  Histidine metabolism
bfl01100  Metabolic pathways
bfl01110  Biosynthesis of secondary metabolites
bfl01230  Biosynthesis of amino acids
Module
bfl_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bfl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Bfl466 (hisH)
Enzymes [BR:bfl01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     Bfl466 (hisH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase SNO Peptidase_C26 GATase_3
Motif
Other DBs
NCBI-ProteinID: CAD83525
UniProt: Q7VQW7
Position
514238..514828
Genome map
AA seq 196 aa AA seqDB search
MKIIIINTNCSNLSSVKIMLNKLGCNTIITDDPDLIIQSDKILLPGVGTANTAMKQLKKK
NLIQLIKKCTQPTLGICLGMQLFGSFSNENTHTNTLNIINVPVKHMYSPTLPIPHMGWNN
ITILKKHDLLNGINNNHYFYFAHSYCMELNYTTIAYTNYGQPFSSVIVYKNFFGVQFHPE
KSSFSGEQLIKNFLEI
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataattattattaataccaattgttctaatttatcatctgtaaaaattatgtta
aataaattaggatgtaacacaataattactgatgatcctgatctcatcattcaatcagat
aaaatacttttacctggagtaggaactgctaatactgctatgaaacaattgaaaaaaaaa
aatctcattcaattaataaaaaaatgtacccaacccaccctaggtatttgcttaggtatg
caattatttggatcatttagcaatgaaaacactcatacaaatactttaaatattattaat
gttccagtaaaacatatgtattctcctaccctccctattcctcatatgggatggaataat
attactattttaaaaaaacatgatttattaaatggcataaacaacaaccattatttctat
tttgcacatagctactgcatggaattaaactataccaccattgcttatactaattatgga
caaccatttagctcagtaatagtatataaaaatttttttggagtacaattccacccagaa
aaatcaagtttttctggagaacaattaattaaaaatttcctggagatataa

DBGET integrated database retrieval system