KEGG   Brevibacillus formosus: BP422_02465Help
Entry
BP422_02465       CDS       T04939                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bfm  Brevibacillus formosus
Pathway
bfm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BP422_02465
Enzymes [BR:bfm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BP422_02465
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BP422_02465
    1.1.1.-  
     BP422_02465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C Shikimate_DH ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ASJ57420
UniProt: A0A220MS82
Position
complement(482505..483557)
Genome map
AA seq 350 aa AA seqDB search
MKALRWHGLKDLRLETISEPVATKGKVKIRVEWCGICGSDLHEYVAGPIFIPQGAEHPLT
GEKAPIVMGHEFSGQVVEIGEGVNTVKVGDRVVVEPVFACGTCAACRQGKYNLCEKMGFL
GLAGGGGGFSEYVACDEHMVHKIPDSLSYEQGALVEPSAVALYAVRSSQLKAGDKAVVFG
AGPIGLLVIEALKAAGAAEIYAVELSPERKNKAAELGAIVIDPKEYDVVQEIHNRTNGGA
DIAFEVTGVPPVLTQAIESTKIAGQIMIVSIFEREAPIKPNHIVMKERNMTGIIGYRDVF
PAVISLMEKGFFPADKLVTQRIKLDDIMENGFEALLKEKNQVKILVSPRA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttacgttggcacggtttgaaggacctccgtttggaaaccatttcggaaccg
gttgcgaccaaaggtaaagtgaaaattagagttgagtggtgcgggatttgcggaagcgac
ttgcacgaatacgtggctggcccgatcttcatcccacagggagctgaacatccacttaca
ggcgaaaaagccccgatcgtgatggggcatgaattttccggacaagtagtggaaatcggc
gaaggcgtgaacaccgtcaaggttggcgatcgcgtcgttgtcgaaccagttttcgcatgc
ggaacatgcgctgcgtgcagacaaggcaaatacaatctttgtgaaaaaatgggcttcctc
ggtttggctggaggtggtggcggcttttcggaatacgtggcttgcgatgagcacatggtt
cacaaaatcccagacagtctctcctatgagcaaggcgctcttgttgagccatctgccgtg
gccctttatgcagtccgttcgagccagttgaaagctggtgacaaagctgtcgtattcggc
gccggtcctatcggcttgcttgtcattgaagcactaaaagcagcaggtgcagctgagatt
tatgcagtggagctgtcccccgaacgtaaaaacaaggcagctgagctgggcgctatcgtc
atcgatccaaaagaatacgacgtcgtccaggaaattcacaaccggacgaatggtggcgca
gatatcgcctttgaagtcacaggtgtgcctcctgtccttacgcaagccatcgaatctacc
aaaatcgctggacaaatcatgatcgtcagcatcttcgaaagagaagcgccaatcaagcca
aatcacatcgtcatgaaagaacgcaacatgacaggcatcatcggctaccgcgacgtattc
cctgccgtcatcagcctgatggaaaagggcttcttccctgcagacaagctggtcacccag
cgcatcaagctcgacgacatcatggagaatggttttgaagcactgttgaaagagaaaaac
caggtgaaaattctcgttagcccgagagcataa

DBGET integrated database retrieval system