KEGG   Brevibacillus formosus: BP422_07585Help
Entry
BP422_07585       CDS       T04939                                 

Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
bfm  Brevibacillus formosus
Pathway
bfm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bfm01100  Metabolic pathways
bfm01110  Biosynthesis of secondary metabolites
bfm01130  Biosynthesis of antibiotics
bfm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bfm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BP422_07585
Enzymes [BR:bfm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     BP422_07585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ASJ53431
UniProt: A0A220MEJ6
Position
1550007..1551032
Genome map
AA seq 341 aa AA seqDB search
MLTYALEQILLGKHLTRTVAEEAMGEIMDGKATPAQIGAFLASLRLKGEQVEEIIGFAKA
MRARAMSFPIDLPGLVDTCGTGGDGSHTFNISTASAVVAAADGVRIAKHGNRAVSSKSGS
ADVLEALGVPVNLSPKDAADCLRATNLCFLFAPLYHQAMKHTAGPRKELAIRTVFNLLGP
LTNPAGATHQLMGVYDAKLLPTVAAVLHELNVKRALVVAGSDGLDELTVTGTSHIAELRD
GRIQTYEIEPEQFGLRRHEKDALRGGDANENAKIIHDVFSGARGAARDIVLLNAGAILYL
ADQASSIETGVIRAAELIDGGLVMRKLEHVRHIAGGMIHAS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgtacgcgctagaacaaattctgcttgggaagcacttaacacgaacggttgca
gaagaggccatgggcgagattatggacggaaaggcaactccagctcagatcggtgcattt
ttagcgagtcttcgcttgaaaggcgagcaggtggaagagattatcggttttgccaaagcc
atgagagcgcgggcgatgagttttcccatcgatctgccgggtctggtagacacttgcgga
acaggcggagacggaagtcatacttttaacatttcgacggcgagtgcagttgtcgcagca
gctgacggtgtacgcatcgccaagcacgggaatcgtgcggtttccagcaaaagcggcagt
gctgatgtgttggaagcgttgggagtgcccgtcaatttatctccaaaggacgccgcagat
tgcctgcgtgcgaccaatctctgcttcctgttcgctcccctttaccaccaagcgatgaag
catacggctggtccgcgaaaagaattggcgattcgcacggtgtttaatttactggggcca
ttgacgaatccagcaggtgccacccatcagttgatgggcgtctatgatgccaaactgctt
ccgactgtagccgcagtcttacacgagctcaatgtgaaaagagcgctcgttgtagcaggc
tcggatggtttggatgaattgactgtcacgggaacgagccatattgccgagttgcgggat
gggcgtattcagacatatgaaatcgaaccagagcagttcggtctgcgcagacatgagaag
gatgctttgcgcggcggtgatgccaatgagaatgccaagatcattcacgacgtgttttcc
ggagcgcgtggggcagcacgcgacatcgttttgctgaatgcgggtgcgattctctacctc
gcagatcaggctagttcgattgaaactggagttatacgtgcagcagaactgatcgacggc
ggactggtcatgcgcaagctggagcacgttcgtcacatcgcaggaggtatgatacatgct
tcgtaa

DBGET integrated database retrieval system