KEGG   Brevibacillus formosus: BP422_09685Help
Entry
BP422_09685       CDS       T04939                                 

Definition
(GenBank) 4-hydroxyphenylacetate 3-hydroxylase
  KO
K16901  anthranilate 3-monooxygenase (FAD) / 4-hydroxyphenylacetate 3-monooxygenase [EC:1.14.14.8 1.14.14.9]
Organism
bfm  Brevibacillus formosus
Pathway
bfm00350  Tyrosine metabolism
bfm00380  Tryptophan metabolism
bfm01100  Metabolic pathways
bfm01120  Microbial metabolism in diverse environments
bfm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bfm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BP422_09685
   00380 Tryptophan metabolism
    BP422_09685
Enzymes [BR:bfm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.8  anthranilate 3-monooxygenase (FAD)
     BP422_09685
    1.14.14.9  4-hydroxyphenylacetate 3-monooxygenase
     BP422_09685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpaB_N HpaB
Motif
Other DBs
NCBI-ProteinID: ASJ53798
UniProt: A0A220MFK6
Position
2101229..2102716
Genome map
AA seq 495 aa AA seqDB search
MGIRTGDQYIRGLRTRQPEIWLQGRKVTNVCEEAVFRQPIHEIAKLYDMQHDEKYQEKIT
HICQETGERVNNAFLVAKTPEELQAKRALYEAYAEATFGLMGRTPDFLNVVLTSLYSNAS
FLERYNPQWAENVKNYYKYVRDQDLFLTHAIINPQNDRSKSSHEQNDEYTHLGAVEETPE
GLIVKGAKMLATLAPITDEVIIYSFPGFQPGDERYALAFAIPINTPGLRIICREPMQDGI
RSFYDHPLASRFEEMDAVLVFHDVLVPWERLFLYNNVEAANLLYPKTGIGQQPAHQTGVR
GLLKLQFATEVAMRLADSIGVDVFPNVQNNLGELAQSLESVRALLKTAELEYETLPSGEL
MPGYVQLETIRGLLPKLYPRVIEVIQIIGAGGLLMSPTDSDMEHPELAEDMEKFYAGRKG
ISGTDRIRMFKLAWDLCGEAFGQRLLQYERYYTGDPVRKLAIFYNNYKKSHACAMVDDAL
SVFEAKSASKTEQVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgggaatccgtacaggtgaccaatacattcggggcttgagaacacggcaaccggagatt
tggctacaagggagaaaggtgacaaatgtatgtgaggaagctgtttttcggcagccgatt
catgaaatagccaagctgtatgacatgcagcatgacgagaagtaccaggagaagattacc
catatttgtcaggagaccggtgagcgtgtgaacaacgcctttctcgttgcaaagactcct
gaggaattgcaggcgaaacgagccttgtacgaagcttatgcggaagccacttttggcttg
atgggaagaacgccggattttctcaatgtcgtcttgacgtcgctatacagtaatgcgtct
ttcttggaaaggtacaatccgcagtgggcggaaaacgtgaagaattattacaagtatgtg
cgagaccaagacttgtttttaacgcatgcaattatcaatccgcaaaatgaccgcagcaag
tcctcgcacgaacaaaacgatgagtacactcatttgggggcagtagaggagacaccggaa
gggctgattgtcaaaggagcgaaaatgctcgcaacactggctccgatcacggatgaagtc
atcatttactcgttccctgggttccagccaggagatgagcgttacgcattggcatttgcc
attccgattaacacgccgggtttgcgcatcatttgtagagagcctatgcaggatggaatt
cgttccttttatgaccatcctttggcatcgcgcttcgaagaaatggatgctgttcttgtc
tttcatgacgtactcgtgccttgggagcgcttattcctgtacaacaatgtagaagcagcc
aacctgctttatccaaagacaggcatcggacaacagccggcgcaccagacaggggtgaga
ggtctgttgaagctccaatttgccacggaagtcgccatgcggctggctgactccatcggg
gtagacgtctttccgaatgtccaaaacaatctcggggagctggcgcaatcgctggaatcg
gtcagagcgctgctgaagacagctgagctggaatacgagaccttgccgtcgggcgagctc
atgccaggttacgtacagctcgaaaccattcgcggactgcttccgaagctgtacccgcga
gtgatcgaagtcatacaaattattggagcaggcggattgctcatgtccccgactgactct
gacatggagcatcccgagttggcagaggatatggaaaagttttatgcgggacgaaagggt
atctctggtacagataggattcgcatgtttaagctcgcttgggacttgtgcggggaagcc
ttcggacagcgtctactgcaatacgaacggtactatacaggtgatccggtgcgcaaatta
gcgattttttacaacaactataagaagtctcatgcctgcgcgatggtggatgacgcgctc
agcgtttttgaagccaaatcggcatcgaaaacggagcaggttctttaa

DBGET integrated database retrieval system