KEGG   Brevibacillus formosus: BP422_22960Help
Entry
BP422_22960       CDS       T04939                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bfm  Brevibacillus formosus
Pathway
bfm00071  Fatty acid degradation
bfm00072  Synthesis and degradation of ketone bodies
bfm00280  Valine, leucine and isoleucine degradation
bfm00310  Lysine degradation
bfm00362  Benzoate degradation
bfm00380  Tryptophan metabolism
bfm00620  Pyruvate metabolism
bfm00630  Glyoxylate and dicarboxylate metabolism
bfm00640  Propanoate metabolism
bfm00650  Butanoate metabolism
bfm00900  Terpenoid backbone biosynthesis
bfm01100  Metabolic pathways
bfm01110  Biosynthesis of secondary metabolites
bfm01120  Microbial metabolism in diverse environments
bfm01130  Biosynthesis of antibiotics
bfm01200  Carbon metabolism
bfm01212  Fatty acid metabolism
bfm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BP422_22960
   00630 Glyoxylate and dicarboxylate metabolism
    BP422_22960
   00640 Propanoate metabolism
    BP422_22960
   00650 Butanoate metabolism
    BP422_22960
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BP422_22960
   00072 Synthesis and degradation of ketone bodies
    BP422_22960
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BP422_22960
   00310 Lysine degradation
    BP422_22960
   00380 Tryptophan metabolism
    BP422_22960
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BP422_22960
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BP422_22960
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BP422_22960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bfm04147]
    BP422_22960
Enzymes [BR:bfm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BP422_22960
Exosome [BR:bfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BP422_22960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ASJ56157
UniProt: A0A220MM22
Position
complement(4973268..4974458)
Genome map
AA seq 396 aa AA seqDB search
MSQREIVIASAVRTAIGSFQGTLAGVSATKLGGIVLEAALERAGVSKDAVDEVIMGNVLS
AGVGQNPARQASIHAGLAHEVPSLTINKVCGSGLKAVHLAVQSILAGEAEVVLAGGMENM
SQAPYLMEGARSGYRMGDQKVVDSMIRDGLWCAFNDYHMGITAENLCTKYEIGREEQDEF
SAWSQEKAQQALASGRFQEEIVPVPIPQRKGDPVLFAVDEFPRAGVTAEALGKLKPAFKK
DGTVTAGNASGINDGAAALLIMTREKAEELGVKPLARIVANASAGVDPSIMGYGPVPATK
RVLEKAGLSIADIDLIEANEAFAVQSLSVGKALGFDREKLNVNGGAIALGHPIGASGARI
LVTLVHELQKREGVKYGLATLCIGGGQGVSTIVEKI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaagagaaatcgtcattgcgagtgctgtgcgcactgccataggtagctttcaa
ggaacgcttgcaggtgtcagcgcgacaaagctgggcgggattgtactggaagcagcgctg
gagcgtgcaggtgtttccaaggatgcggtcgatgaagtgattatggggaacgtactgtca
gcaggcgtgggtcaaaacccggcgcgccaggcttctattcacgcgggccttgctcatgag
gttccctccctgacaatcaacaaggtttgtggttcaggtctaaaagccgttcatctggct
gttcagtcaatccttgcaggtgaggcagaagttgtcttggctggtgggatggagaatatg
agccaggcaccatatttaatggaaggtgcgcgctcaggctaccgcatgggagaccagaaa
gtagtagactccatgattcgcgacgggctgtggtgtgctttcaacgactaccacatgggc
attacagcggagaacctttgcaccaaatacgaaatcggacgcgaagagcaggatgaattt
tcagcgtggagccaggaaaaggctcagcaagcgctcgctagtggtcgttttcaggaagaa
atcgtgccggtaccgatcccgcagcgcaagggtgatccggtgctgtttgccgtagacgaa
ttcccgcgtgctggcgtgacagccgaggcactaggcaaactaaagcctgcatttaaaaag
gatggaaccgtgacagccgggaatgcatctggcatcaacgatggagcagcagctcttttg
atcatgacacgcgagaaggcagaagagctgggtgtgaagcctctcgcccgtatcgtagct
aatgcgagtgcaggtgttgatccgagcatcatggggtacggtccagttcctgcgaccaaa
cgcgtactggaaaaagcgggtctgtcgattgctgatatagacttgatcgaagcaaatgaa
gcttttgccgtccaatcgctgtctgttggcaaagcactaggctttgatcgcgagaagctg
aatgtcaatggcggagccattgctttgggacatccaattggtgcgagtggcgcgagaatc
ttggtcacgctcgtgcatgaattgcaaaaacgcgaaggggtaaaatatggattagcaacc
ctttgcatcggcggtggacaaggggtctctacaattgtcgagaaaatttaa

DBGET integrated database retrieval system