KEGG   Brevibacillus formosus: BP422_26545Help
Entry
BP422_26545       CDS       T04939                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bfm  Brevibacillus formosus
Pathway
bfm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bfm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BP422_26545
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bfm03011]
    BP422_26545
Ribosome [BR:bfm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BP422_26545
  Bacteria
    BP422_26545
  Archaea
    BP422_26545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ASJ56779
UniProt: A0A220MPY4
Position
5708322..5708654
Genome map
AA seq 110 aa AA seqDB search
MEAKAVARNIRIASRKVRLVVDLIRGKQVGEALAILKHTPKAASPVVEKLLKSAIANAEH
NYELDPNSLVVGKIFVDQGPTLKRFRPRAMGRASRIHKRTSHITVVLNEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcagttgcacgcaatattcgtatcgcgtctcgtaaagtccgcctggtg
gttgacttgatcagaggcaagcaagtaggtgaagctttggcgatcttgaaacacacgcca
aaggcagcttctccagttgttgaaaaactcctgaagtcggctattgcaaacgctgagcac
aactatgagctggatccaaacagcctcgtagtgggtaaaatcttcgtagaccaaggtcct
acgttgaagcgtttccgtccgcgcgctatgggtcgcgctagccgcatccataaacgcacg
agccacatcacagtggtactaaacgagaaataa

DBGET integrated database retrieval system