KEGG   Paraburkholderia fungorum: OI25_2009Help
Entry
OI25_2009         CDS       T03799                                 

Definition
(GenBank) SMP-30/Gluconolaconase/LRE-like region family protein
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00053  Ascorbate and aldarate metabolism
bfn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    OI25_2009
Enzymes [BR:bfn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     OI25_2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL PD40
Motif
Other DBs
NCBI-ProteinID: AJZ57636
Position
1:2254562..2255506
Genome map
AA seq 314 aa AA seqDB search
MSAGPRTGQPAPRAALLLDTQCTLGEGATWCARTGRFYWTDIEGARLWRYDPSDGQSTSW
LMPERLATFALCADPRYLLLGLATHLAFFDLATGVTQHIVDVEADLNTRVNDGRCDRQGR
FVFGTKDEGSPLRALGGFYRLNHDLSLERLPLPAPAISNSIAFSPDGATMYYCDSPTREI
RVCDYRADGSIANDRVFTTLTDTTGEPDGSTVDGDGGVWSAQWGGRRVVRYGPDGVETER
VDVPTAQPSCVAFGGPPSGLPAGHAAQLDTLYITSARIDLDAVALATDAHAGGVFIATPG
RQGLQEPVFQGSPA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcggggccgcgtacaggtcagccggcgcctcgcgcggcgttgctgctcgatacg
caatgcacgctcggcgaaggcgcgacgtggtgcgccagaacaggccgcttttactggacc
gatatcgaaggcgcgcgtttgtggcgctatgacccgagcgacggacaaagcacgtcctgg
ctcatgcccgagcgtctcgccacgtttgcgttgtgcgccgacccccgctacctgctgctc
ggattggcgacgcatctggcgttcttcgatctggcaacaggtgtgacgcagcatatcgtc
gacgtcgaagcggatttgaatacgcgcgtgaacgacggccgttgcgaccgtcagggccgt
ttcgtcttcggcacaaaggacgaaggctctccgctgcgggcgctcggcgggttttatcgt
ctgaatcacgatttgtcgctggagcggctgccgttacctgcgccggcgatctcgaacagc
atcgcgttcagtcctgacggtgcgacgatgtattactgcgattcgccaacgcgtgaaatt
cgcgtttgcgactatcgcgcggacggcagcatcgccaacgatcgcgtcttcacgacattg
acggacacaaccggcgaacccgacggctcgacggttgacggtgacggcggtgtgtggagt
gcgcagtggggcggcaggcgagtggtgcgatatggacccgacggcgtggaaaccgaacgc
gtcgacgtaccgactgcgcaaccgagctgtgtcgcgtttggcggtcctccgagcggactt
cccgctggacacgccgcgcaactggacacgctgtacattacgagcgcgcgcatcgatctc
gatgccgtggcgctcgcgaccgatgctcacgcgggcggagtatttatcgcaacgcctggg
cgacagggtttgcaggagccggtgtttcaaggctcgcctgcctag

DBGET integrated database retrieval system