KEGG   Paraburkholderia fungorum: OI25_2097Help
Entry
OI25_2097         CDS       T03799                                 

Gene name
ggt
Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00430  Taurine and hypotaurine metabolism
bfn00460  Cyanoamino acid metabolism
bfn00480  Glutathione metabolism
bfn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    OI25_2097 (ggt)
   00460 Cyanoamino acid metabolism
    OI25_2097 (ggt)
   00480 Glutathione metabolism
    OI25_2097 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bfn01002]
    OI25_2097 (ggt)
Enzymes [BR:bfn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     OI25_2097 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     OI25_2097 (ggt)
Peptidases and inhibitors [BR:bfn01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   OI25_2097 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AJZ57691
Position
1:2352377..2354014
Genome map
AA seq 545 aa AA seqDB search
MTGFNWQNPYPTPRLPVFARNIVSTSHPLAAQAGLRMLWKGGNAVDAAIAAAAAITVVEP
VSCGLGGDAFALVWDGKKLHGLNASGVSPAAWNVDYFKRKYGEEDGLAKQPKRGWDAVTV
PGVIAGWEALHQKFGSLPFAALMEPAIEIAERGHAVASIVAYKWAAAVPELKDLPGFAQT
FMPRGRAPEVSELVRFPGHAKTLRKLAEQGPRAYYEGEIAEQIAAFAREGGGALTLDDLR
NYKADWVEPIGKDYRGYTVHEIPPNGQGIAALIALGILEKFDVKELAVDNIESQHLQIEA
MKLAFADVYRYVADPRSMDVTPEQMLDDAYLTSRAKLIDHKRATQFDFGMPKAGGTIYMS
VADERGMMVSFIQSNYMGFGSGIVVPDSGIAMQNRGCGFSMDPKSPNVVEGGKRPFHTII
PSFLTQQVDGKQEAVMSFGVMGGDMQPQGHLQSIVRMLDYGQQPQAACDAPRWKVNRDFT
IDIESTLNPKTAEALQKLGHTIKSVDDPYMDFGSGQYIWKLDRNDPERGYVAASDSRRDG
LAAGF
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgactggcttcaactggcaaaacccctatccgacgccgcgtctgcccgtattcgcgcgc
aacatcgtttccacttcgcatccgctcgccgcgcaagccgggctgcggatgctgtggaaa
ggcggcaatgccgtcgacgcggcgatcgcggccgccgcggccatcacggtggttgagccg
gtgtcgtgcggccttggcggcgacgcgttcgcgctggtatgggacggcaagaaactgcat
ggtctgaatgcgtcgggcgtctcgccggcggcgtggaatgtcgattacttcaagcgcaag
tacggcgaagaagatggtctcgcgaagcaacccaagcgcggttgggacgcagtgacggtg
cccggcgtgattgccggctgggaagcgctgcatcagaaattcggttcgctgccgttcgcc
gctctgatggagccggcgatcgaaatcgccgagcgcggtcatgcggtggcgagcatcgtc
gcttataaatgggcggcggcggtaccggaactgaaggacctgccgggcttcgcgcaaacc
ttcatgccgcgcggccgcgcgccggaagtgagcgaactggtgcgctttcccggtcacgcg
aagacgctgcgcaagctggctgaacaaggcccgcgtgcgtactacgaaggcgagatcgcc
gaacagatcgcggcgtttgcgcgtgaaggcggcggtgcgttgaccctcgacgatctgcgc
aactacaaggcggattgggtcgagccgatcggcaaggattatcgcggctacaccgtgcat
gagattccgccgaacggccagggcatcgcggcgctgatcgcgctgggcatcctcgaaaag
ttcgacgtgaaggaactggctgtcgacaacatcgagtcgcagcatttgcagatcgaagcg
atgaagctggcgttcgccgacgtctaccgttacgtggccgatccgcgttcgatggacgtc
accccggagcagatgctcgacgacgcgtacctcacgtcgcgcgcgaagctgatcgaccac
aagcgggccacgcagttcgacttcggcatgccgaaggccggcggcacaatctacatgtcg
gtggcggacgagcgcggcatgatggtcagcttcatccagtcgaactacatgggcttcggc
tcgggcatcgtggtgccggacagcggcatcgcgatgcagaaccgcggctgcggcttctcg
atggaccccaagtcgccgaacgtggtggaaggcggcaagcggccgttccacaccatcatc
ccgtcgttcctcacccagcaggtggacggcaagcaggaggcggtgatgagtttcggcgtg
atgggcggcgatatgcagccgcaaggccatctgcaatcgatcgtgcggatgctcgactac
ggtcagcagccgcaggccgcctgcgacgcaccgcgctggaaggtcaaccgggacttcacg
atcgatatcgaatcgacgctcaatccgaagaccgccgaggcgttgcagaagctgggccac
acgatcaagtcggtcgacgatccgtacatggacttcggctcgggccagtacatctggaag
ctcgaccgtaacgatccggagcgcggctacgtggcggcgagcgatagccgtcgcgacggg
ctggcagccggcttctga

DBGET integrated database retrieval system