KEGG   Paraburkholderia fungorum: OI25_2209Help
Entry
OI25_2209         CDS       T03799                                 

Definition
(GenBank) methylated-DNA--[]-cysteine S-methyltransferase family protein
  KO
K00567  methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63]
Organism
bfn  Paraburkholderia fungorum
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bfn03400]
    OI25_2209
Enzymes [BR:bfn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.63  methylated-DNA---[protein]-cysteine S-methyltransferase
     OI25_2209
DNA repair and recombination proteins [BR:bfn03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    OI25_2209
 Prokaryotic type
    OI25_2209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_binding_1
Motif
Other DBs
NCBI-ProteinID: AJZ59289
UniProt: A0A0D5VBR4
Position
1:2486153..2486623
Genome map
AA seq 156 aa AA seqDB search
MFNAVIDAPFGKVGIRLEGEAVREIVYLPESVQSVAPDTLLARQAAGQIERYFERASAKF
ELPLAQVGTAFQRRVWQAISDIPPGVVLTYGQLARQIGSVPRAVGQACGSNYFPIVVPCH
RVVSSSGIGGFAHTGGDGFFRNVKRWLLAHEGIPYA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacgcagtgatcgatgcaccgttcggcaaggtcggcattcgtctcgaaggcgag
gccgtgcgcgagatcgtctatttgccggagtcggtgcaaagcgttgcaccggacacgcta
ttggccagacaggcagccgggcagatcgagcgttatttcgagcgtgcgtcggcgaagttc
gaattgccactggcgcaggtcggcaccgcgttccagcgccgcgtgtggcaagcgatcagc
gacatcccgcccggtgtcgtgctgacctatggacaactggcacggcagatcggcagcgtc
ccgcgcgcggtcggccaggcgtgcggctccaactatttcccgattgtggttccgtgtcat
cgggtggtgagttcgagcgggatcggcggattcgcgcatacgggtggcgatggcttcttt
cgcaacgtcaagcgttggcttctggcgcatgaaggtattccctacgcatga

DBGET integrated database retrieval system