KEGG   Paraburkholderia fungorum: OI25_255Help
Entry
OI25_255          CDS       T03799                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00360  Phenylalanine metabolism
bfn00362  Benzoate degradation
bfn00621  Dioxin degradation
bfn00622  Xylene degradation
bfn01100  Metabolic pathways
bfn01120  Microbial metabolism in diverse environments
bfn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    OI25_255 (dmpG)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OI25_255 (dmpG)
   00622 Xylene degradation
    OI25_255 (dmpG)
   00621 Dioxin degradation
    OI25_255 (dmpG)
Enzymes [BR:bfn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     OI25_255 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm Bac_luciferase AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AJZ58176
Position
1:complement(302712..303752)
Genome map
AA seq 346 aa AA seqDB search
MTDSNKKIYVSDVTLRDGMHAIRHQYSLDDAVAIARALDEAGVDSIEVAHGDGLSGSSFN
YGFGAHTDLEWIAAVAGTVKRAQVATLLLPGIGTVHDLRAAYDAGARIVRIATHCTEADI
SKQHIEYARSLGMDTVGFLMMSHMTTPDALAKQAKLMESYGAQCVYVVDSGGALNMRDVA
ERLDAFKAALDPATQTGMHAHHNLSLGVANSVVALEHGCDRIDASLTGMGAGAGNAPLEV
LIAAVDRMKLNHGCDVKKLIDAAEDIVRPLQERPVRVDRETLALGYAGVYSSFLRHTEAA
AAKYGLSAFDIMVELGKRRMVGGQEDMIVDVALDMLKARELAKEAA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatagcaacaagaaaatttatgtgtcggacgtgacgctgcgcgacggcatgcac
gcgattcgccatcagtactcgttggacgacgccgtagcgatcgcgcgagcgctcgatgaa
gccggcgtcgacagtattgaagtcgcgcacggcgacggtctctcaggttcgagctttaac
tatggtttcggcgcgcacaccgatctcgaatggatcgcagcggtcgcgggcacggtcaag
cgcgcgcaagtggcgacgctgctgttgcccggcatcggcaccgtccacgatctgcgggcg
gcgtacgacgccggcgcgcgcatcgtgcggatcgccacgcattgcaccgaagcggatatc
tcgaagcagcacatcgaatacgcccgctcgctcggcatggatacagtcggcttcctgatg
atgtcgcacatgaccacgcccgacgccttggcgaagcaggcgaagctgatggaaagctac
ggcgcgcaatgcgtctatgtggtcgattcgggcggcgcgctgaacatgcgcgacgtcgcc
gagcgtctcgacgccttcaaggcggcgctcgatccggccacgcaaacgggtatgcacgcg
catcacaatctgtcgctaggcgtggcgaattccgtggtcgcgctcgaacacggttgcgac
cgcatcgatgcatcgctgacgggcatgggagcgggtgcgggtaacgcgccgctcgaagtg
ctcatcgccgcggtagaccggatgaaactcaatcacggttgcgatgtgaagaaactgatc
gacgccgcggaagacatcgtgcgtccgttgcaggagcggccggtgcgcgtggatcgcgaa
acgctggcgctcggctatgccggcgtgtattcgagctttctgcgccacactgaggcggct
gcggcgaaatacggcctgtcggccttcgacatcatggtcgagctcggcaagcgccgcatg
gtcggcggccaggaagacatgatcgtcgacgtcgcgctggatatgctgaaggcgcgcgaa
ctcgcgaaggaggccgcatga

DBGET integrated database retrieval system