KEGG   Paraburkholderia fungorum: OI25_3035
Entry
OI25_3035         CDS       T03799                                 

Definition
(GenBank) dihydrodipicolinate synthetase family protein
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00626  Naphthalene degradation
bfn01100  Metabolic pathways
bfn01120  Microbial metabolism in diverse environments
bfn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    OI25_3035
Enzymes [BR:bfn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     OI25_3035
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AJZ57657
Position
1:3409686..3410681
AA seq 331 aa
MLQANDIRGLYAIIPTPAHAGAERFDACHTVDLEETARLVTRLIGDGCDGLIALGTTGEC
ATLSQEDYEAFVGCVTEVVNKRIPTFFGASAMGGHEVAKRMKFLCDRDVEGTLLGLPMWQ
PLTVDTAVNFYSALGGLFPEIAIMVYANERAFRFSFPDEFWEAVARVAPTVTSAKYARPK
DLKRLLAVTGGRINIIPNEMSIAHFFDEAPGSTTACWATAASMGPKPTIELMRAVERQDI
EAVKRLSGAMAWANAPVAPIIADKEAFTLYNIQIEKTRINAAGYCNAGPVRPPYGPMPAH
YTQASEECGRRWGMLSARMASGSAIDDLTPV
NT seq 996 nt   +upstreamnt  +downstreamnt
atgctgcaagcaaatgacattcgcggcttatacgcgatcatcccgacaccggcccatgcc
ggagccgaacgattcgacgcgtgtcacaccgtagacctcgaggaaacggcccggctggtc
acgcggttgattggtgacggttgcgatgggttgattgcacttgggacaacgggggaatgt
gcgacgctgtcacaggaagactacgaagccttcgtcggttgcgtgacagaagtagtcaac
aagcgcataccaacctttttcggtgcgtcggcaatgggcggccatgaagtagcaaagcgc
atgaagttcctgtgcgatcgcgacgtggaaggcacgctattgggtctgccgatgtggcag
ccactgacagtcgatactgccgttaatttctattccgcactcggcggcttgtttcccgag
atcgcaatcatggtttatgccaatgagcgtgctttccgcttttcgtttccagacgaattt
tgggaagccgtggcgcgcgttgcacccaccgtcacatcggctaaatatgcacggccgaag
gatttgaaacgcttgcttgcggtcactggcgggcgtatcaatatcattcccaatgaaatg
tcgatcgcgcatttttttgacgaggcgcctggatcgacgacagcgtgctgggcgacggcg
gcaagtatggggccgaaaccgaccattgaattgatgcgcgcagtggagcgacaggatata
gaagcggtcaagcgactgtccggcgcaatggcatgggcgaatgcgccagtggcaccgatc
atcgccgacaaggaggcgttcacactctacaacatccagatcgagaaaacccgcatcaat
gcagccggctattgcaatgcgggaccggtaaggccaccttacggaccgatgccggcgcat
tacactcaggcatccgaagaatgtgggaggagatgggggatgctgtccgcgcggatggca
tccggttccgcaatcgatgatctgacgccggtctga

DBGET integrated database retrieval system