KEGG   Paraburkholderia fungorum: OI25_3053
Entry
OI25_3053         CDS       T03799                                 

Gene name
phdJ
Definition
(GenBank) trans-2'-carboxybenzalpyruvate hydratase-aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00626  Naphthalene degradation
bfn01100  Metabolic pathways
bfn01120  Microbial metabolism in diverse environments
bfn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    OI25_3053 (phdJ)
Enzymes [BR:bfn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     OI25_3053 (phdJ)
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AJZ59845
Position
1:3430130..3431122
AA seq 330 aa
MSKQRKQRLGTEDVNGAWVIMPTPAKPEASDWRATDTVDLDETARIVEALIDSGVNGILS
LGTFGECATLTWEEKQAFIGAVVETTRGRVPFFCGTTALNTREVVRQTRAALDIGVDGTM
LGVPMWSRMEVPAAVQFYRDVAEACPEAAIAVYANADAFKFEFPRAFWAQVAQIPQVVTA
KYLGIGMLDLDLTLAPGIRFLPHEDDYYAAARVAPERVTAFWSSGAMCGPATAIRLRDEV
AKAKQTGDWRLAKELSDAMRRADATLFPRGDFAEFSKYNIAIEKERMNAAGWLRAGPCRP
PYHIAPEEYLDGARQSGRAWAELHQQYSDL
NT seq 993 nt   +upstreamnt  +downstreamnt
atgagcaaacaacgcaaacaacgtctcggaaccgaagacgtcaacggggcgtgggtcatc
atgcccaccccagctaaaccggaagcctctgactggcgcgccaccgacacggtcgatctg
gatgagaccgcccgcattgtcgaggcgctgatcgattccggcgtgaatggcattcttagc
ctgggcactttcggcgaatgtgccacgctgacctgggaggaaaagcaggcttttattggc
gccgtcgtcgagactacgcgtggccgcgtgccatttttctgcggtaccactgcgctcaac
acgcgtgaggtggtccgccagacgcgtgccgcactggacatcggcgttgacggtacgatg
ctcggcgtaccgatgtggtctaggatggaagtgcctgccgctgtgcagttctaccgcgac
gtcgcggaggcctgccccgaagccgcgatcgcggtctatgcaaacgcggatgcgttcaag
ttcgaattcccgcgcgccttttgggcccaggtagcccagattccgcaggtcgtcaccgcc
aagtatctgggcatcggaatgctggacctcgatctcacgctggcaccgggcattcgcttc
ctgccgcacgaggacgactactatgcggccgcgcgcgtggcgccagagcgcgtgaccgcg
ttttggtccagtggtgcgatgtgcgggccggccacagctattcgactgcgcgacgaggtg
gcgaaggccaagcagaccggggattggcgtctcgccaaggaactttcagacgcgatgcgg
cgtgccgacgccacgctgtttccgcgcggggatttcgccgaattctccaaatacaatatc
gccatcgagaaggagcgcatgaacgccgctggctggctcagagcggggccatgccggcct
ccctatcacattgcgccagaagagtatctggatggtgcacgccagtcgggcagggcatgg
gccgaattgcaccagcaatattcagatctgtaa

DBGET integrated database retrieval system