KEGG   Paraburkholderia fungorum: OI25_3421Help
Entry
OI25_3421         CDS       T03799                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00071  Fatty acid degradation
bfn00072  Synthesis and degradation of ketone bodies
bfn00280  Valine, leucine and isoleucine degradation
bfn00310  Lysine degradation
bfn00362  Benzoate degradation
bfn00380  Tryptophan metabolism
bfn00620  Pyruvate metabolism
bfn00630  Glyoxylate and dicarboxylate metabolism
bfn00640  Propanoate metabolism
bfn00650  Butanoate metabolism
bfn00900  Terpenoid backbone biosynthesis
bfn01100  Metabolic pathways
bfn01110  Biosynthesis of secondary metabolites
bfn01120  Microbial metabolism in diverse environments
bfn01130  Biosynthesis of antibiotics
bfn01200  Carbon metabolism
bfn01212  Fatty acid metabolism
bfn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bfn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OI25_3421
   00630 Glyoxylate and dicarboxylate metabolism
    OI25_3421
   00640 Propanoate metabolism
    OI25_3421
   00650 Butanoate metabolism
    OI25_3421
  Lipid metabolism
   00071 Fatty acid degradation
    OI25_3421
   00072 Synthesis and degradation of ketone bodies
    OI25_3421
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OI25_3421
   00310 Lysine degradation
    OI25_3421
   00380 Tryptophan metabolism
    OI25_3421
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OI25_3421
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OI25_3421
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OI25_3421
Enzymes [BR:bfn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OI25_3421
Exosome [BR:bfn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OI25_3421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: AJZ60055
UniProt: A0A0D5VDF6
Position
1:3835416..3836600
Genome map
AA seq 394 aa AA seqDB search
MQRDVVVVSGVRTAIGGFGGSLKDFPPTDLAARVVREALARANVSGDEVGHVVFGNVVHT
EPKDMYLARVAAINGGVAQHAPALTVNRLCGSGLQAIVSAAQSVLLGDADIAIGGGAENM
SRAPYSMPAARFGQRMGDARLVDMMVGALNDPFQSIHMGVTAENVARKYEISREAQDALA
LESHRRAANAITSGYFKDQILPITIPSKKGDVVFDTDEHARMNATAEDFSKLKPVFVKEN
GTVTAGNASGINDAAAAVVLMERSVAEKRGIKPLARLVSYAHAGVDPAYMGIGPVPATRK
ALERAGLTVADLDVIEANEAFAAQACAVSKELGLDPAKVNPNGSGISLGHPIGATGALIT
VKALYELQRIGGRYALVTMCIGGGQGIAAIFERV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgagacgtagtggtggtaagcggtgtgcgtacggcaatcggcggttttggcggc
agcctgaaggattttccgccgacggatcttgccgcacgcgtcgtgcgcgaagccttggcg
cgcgcgaatgtgtcgggtgacgaagtgggccacgtggtgttcggcaacgtcgtgcatacc
gagccgaaagacatgtatctggcccgcgtggcggcgatcaacggcggcgttgcgcaacat
gctccggcgttgacggtcaaccgcctgtgcggttcgggcctgcaggcgatcgtctcggcc
gcgcaaagcgtgctgctcggcgatgccgacatcgcgatcggcggcggggcggaaaacatg
agccgcgcgccgtactcgatgccggctgcgcgtttcggtcagcgcatgggcgatgcgcgc
ctcgtcgacatgatggtcggcgcgctgaacgacccgttccagtcgatccatatgggtgtg
accgccgagaacgtcgcgcgcaagtacgaaatctcgcgtgaagcgcaggacgcgcttgcg
ctcgaatcgcatcgccgtgcggccaatgcgattacgagcggctacttcaaggatcagatc
ctgccgatcacgattccttcgaagaagggcgacgtcgtgttcgatacggacgaacacgcg
cgtatgaacgcgacggccgaagacttctccaagttgaagccggtgttcgtgaaggaaaac
ggcacggtcacggcgggcaacgcgtcgggcatcaacgacgccgccgccgcggtcgtgctg
atggagcgcagcgtcgctgaaaagcgcggcatcaagccgttggcacggctggtttcgtat
gcccacgcaggtgtcgatccggcatacatgggtatcggtccggtgccggcaacacgcaag
gcgctcgagcgcgccggcctgacggttgccgatctcgatgtgatcgaagcgaatgaagcg
tttgccgctcaggcatgcgcggtcagcaaggagcttggcctcgatccggccaaggtcaat
ccgaacggctcgggtatttcgcttggccacccgatcggcgcgaccggtgcgttgattacc
gtcaaggcgctgtatgaattgcagcggattggcggccgctatgcactggtgacgatgtgt
atcggcggcgggcagggtatcgctgcgatcttcgaacgggtctga

DBGET integrated database retrieval system