KEGG   Paraburkholderia fungorum: OI25_4473Help
Entry
OI25_4473         CDS       T03799                                 

Definition
(GenBank) acyl-CoA reductase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00010  Glycolysis / Gluconeogenesis
bfn00053  Ascorbate and aldarate metabolism
bfn00071  Fatty acid degradation
bfn00280  Valine, leucine and isoleucine degradation
bfn00310  Lysine degradation
bfn00330  Arginine and proline metabolism
bfn00340  Histidine metabolism
bfn00380  Tryptophan metabolism
bfn00410  beta-Alanine metabolism
bfn00561  Glycerolipid metabolism
bfn00620  Pyruvate metabolism
bfn00625  Chloroalkane and chloroalkene degradation
bfn00903  Limonene and pinene degradation
bfn01100  Metabolic pathways
bfn01110  Biosynthesis of secondary metabolites
bfn01120  Microbial metabolism in diverse environments
bfn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OI25_4473
   00053 Ascorbate and aldarate metabolism
    OI25_4473
   00620 Pyruvate metabolism
    OI25_4473
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OI25_4473
   00561 Glycerolipid metabolism
    OI25_4473
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OI25_4473
   00310 Lysine degradation
    OI25_4473
   00330 Arginine and proline metabolism
    OI25_4473
   00340 Histidine metabolism
    OI25_4473
   00380 Tryptophan metabolism
    OI25_4473
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OI25_4473
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OI25_4473
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OI25_4473
Enzymes [BR:bfn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     OI25_4473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 LuxC
Motif
Other DBs
NCBI-ProteinID: AJZ62832
Position
2:complement(557939..560350)
Genome map
AA seq 803 aa AA seqDB search
MSVAEYFSSMEYGPAPEDDRPARAWLAQHEAGFGHFIGGAWHAPAAGERFVSHAPATGER
LADIAQGDAADVDAAVAAARAAQPGWLALGGAGRARHLYALARMVQRHSRLFAVLEALDN
GKPIRETRDIDVPLVARHFLHHAGWAQLQESEFADYAPLGVIGQIVPWNFPLLMLAWKIA
PAIAMGNCVVLKPAEYTPLTALLFAELAHRAGLPAGVLNIVTGDGRTGAALVEHPQVDKI
AFTGSTEVGRLIRAATAGSGKSLTLELGGKSPFIVFDDADLDGAVEGVVDAIWFNQGQVC
CAGSRLLVQEGIEARFIAKLKRRMETLRVGTSLDKSIDIGAIVDPVQLERIQSLVETGRR
EGCAVWQSPDTAMPAGGCFYPPTLVTGVAPASILAQEEIFGPVLVAMSFRTPDEAIALAN
NSRYGLAASVWSETIGRALDIAPRLLCGVVWINATNLFDAAVGFGGYRESGYGREGGREG
IYEYLKPRAWLKLAARRDTRAERAERVEPTAGADAPGSLSNVTLIDRTAKLFIGGKQVRP
DSGYSLPVHAPDGTLVGEVGEGNRKDIRNAVEAARAAQKWSQASTHNRAQVLFYLAENLA
VRADEFARQLVTRNGATEAVAHAEVEAAVARLFTYAAWADKFDGAVHTPPLRGVALAMHE
PLGVIGIACPDEAPLLGFVSLVAPALAMGNRVVVLPSAACPLTVTDFYQVAETSDVPGGV
LNIVTGERAALLPALAAHDDVDALWCFGYAADSTLVERESVGNLKRTFVDYGRQFDWFDR
SSEGRPFLRQAVQVKNIWIPYGD
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtagccgagtatttttcatcgatggagtacggtcccgcacccgaggacgatcgc
cctgcgcgcgcgtggctcgcgcagcatgaagcgggcttcgggcatttcatcggcggtgcg
tggcatgcgcccgctgccggcgagcgtttcgtctcgcacgcgcctgccacgggcgagcgg
ctcgcggatatcgcgcaaggcgacgcggccgatgtcgacgcggccgtggccgccgcgcgc
gccgcgcagccgggctggctcgcgttgggcggcgccgggcgggcacgccatctgtatgcg
ctcgcgcgtatggtgcagcggcatagccgcctctttgccgtgctcgaagcactcgacaac
ggcaagccgatccgtgaaacacgcgatatcgacgtaccgctcgtcgcgcggcacttcctg
catcacgcggggtgggcgcaattgcaggagagcgaattcgccgattacgcgccgctcggt
gtgatcggccagatcgtgccgtggaattttccgctgctgatgctcgcgtggaagatcgca
ccggcgatcgcgatgggcaactgcgtcgtgttgaagccggccgaatacacgccgctcacg
gcgctgctgtttgccgaactcgcgcaccgggccggtttgccggccggcgtgctgaacatc
gtgacgggcgacggccgcactggcgccgcgctcgtcgagcatccgcaagtggacaagatc
gcgttcacggggtcgacggaagttgggcgtctgatacgcgcggccacggccggctcgggc
aaatcgctgacgctcgaactcggcggcaagtcgccgttcatcgtattcgacgacgcggat
ctcgacggcgccgtcgaaggagttgtcgacgcgatctggttcaaccaggggcaggtttgc
tgcgcgggctcgcgcctgctggtgcaggagggcatcgaagcgcgtttcatcgcgaagctg
aagcgccgcatggaaacgctgcgcgtgggcacctcactcgacaagagtatcgacatcggc
gcgatcgtcgatccggtgcagctcgaacgtattcagtcgctggtggaaaccggccggcgt
gaaggctgtgcggtgtggcagtcgcccgatacggcgatgcctgccggcggctgtttttat
ccgcctacactcgtcaccggcgtggcgccggcttccattctggcgcaggaagaaatcttc
ggaccggtgctggtcgccatgagttttcgcacaccggacgaagcaattgcgcttgccaat
aactcgcgctacggactcgctgcgagcgtgtggagcgaaaccatcggccgcgcgctcgat
atcgcgccgcgccttctctgcggggtggtgtggatcaacgcgaccaatctgttcgacgcg
gccgttggtttcggggggtatcgcgagtcgggctatggccgggaaggcggtcgcgagggt
atctacgaatatctgaagccgcgcgcctggctcaagctggccgcccgtcgggacacgcgc
gctgaacgcgctgaacgggttgaaccgacagccggcgcagatgcgcccgggtcgttgtcg
aacgtcacgctgatcgaccgtactgcgaagctttttatcggtggcaagcaggtgcgtccg
gatagcggctattcgttgccggttcatgcgccggatggcaccctcgtcggcgaagtgggt
gagggcaatcgcaaggatattcgcaacgcggtcgaagcggcgcgcgcggcgcagaaatgg
tcgcaggcgagcacgcataaccgtgcccaggtgctgttctatctcgcggagaacctggcc
gttcgtgcggacgagttcgcgcggcaactggtgacgagaaacggcgcgacggaagcggtg
gcgcacgcggaagtcgaggcggcggtagcacgcctctttacttacgcggcgtgggccgac
aagttcgatggcgccgtgcatacgccgccactgcgcggtgtcgcgctggccatgcacgag
ccgcttggcgtgatcggtatcgcctgtccggacgaagcgccgttgctcggcttcgtttcg
ctggtggcccccgcgctggccatgggcaatcgtgtggtggtcttgccgagtgcggcgtgc
ccgctcaccgtgaccgatttttatcaggtagccgagacttcagatgtgccgggcggtgtg
ctgaacatcgtcaccggtgagcgcgctgcgctgttgcccgcgcttgccgcacacgacgac
gtcgacgcgctctggtgtttcggttatgcggcggattcgacgctcgtcgagcgcgagtcg
gttggcaatctgaagcggacattcgtcgattatggccgccagtttgactggttcgaccgt
tcgagcgaaggccgcccgtttttgcgtcaggccgtgcaggtgaagaacatctggatcccg
tacggagactga

DBGET integrated database retrieval system