KEGG   Paraburkholderia fungorum: OI25_4612Help
Entry
OI25_4612         CDS       T03799                                 

Definition
(GenBank) 3-beta-hydroxysteroid dehydrogenase
  KO
K05296  3(or 17)beta-hydroxysteroid dehydrogenase [EC:1.1.1.51]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00984  Steroid degradation
bfn01100  Metabolic pathways
bfn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    OI25_4612
Enzymes [BR:bfn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     OI25_4612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AJZ63474
Position
2:complement(719495..720259)
Genome map
AA seq 254 aa AA seqDB search
MGDRLKGKIAVVTGAASGVGKQDALLFAREGARVVLTDVNEEAGREVAAQIGDAALFVRH
DISSETGWNDVFGAAQTTFGTPDVLVNNAAVLLLGSIEDTTLEQWQRVLRINAEGYFLGC
RAAVKAMKEKGGSIVNMSSVAALGGLGMFCAYSASKGAVTAMTRAIAAHCKQQGYKVRCN
TIHPDGILTPMTAPFFGAAEETRDALTQSVDPHGRMCLPEDIANLVLFLASDESRFINGS
EYRIDNAQMIMGIA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggagacagactcaaaggcaagatcgccgtcgtgacgggcgctgcgagcggcgtcggc
aaacaggacgcgttgctgttcgcccgggaaggcgcgcgtgtcgtgcttaccgacgtcaac
gaggaagccggccgcgaagtggctgcgcagatcggcgacgccgcactgttcgtgcgccac
gacatctcgtcggaaaccggctggaacgatgtgttcggcgcggcgcaaacgaccttcggc
acaccggatgtgctggtcaacaacgccgcggtgctgttgctcggcagcattgaagacacc
acgctcgaacaatggcagcgcgtgctgcgcatcaatgccgaaggctattttctcggttgc
cgcgcggcggtcaaggcgatgaaggagaagggcggttcgatcgttaacatgtcgtcggtg
gcggcgttgggcgggctgggtatgttctgtgcctattcggccagcaagggcgcggtgacc
gcgatgacgcgtgcgatcgccgcgcactgcaagcagcagggctacaaggtccgctgcaac
acgattcacccggacggcattctcacgccgatgaccgcgccgttcttcggtgcagccgaa
gaaacccgcgatgcgctcacgcaatcggtcgatccgcacggccgtatgtgtctgccggaa
gacatcgcgaatctggtgctgttccttgcgtccgatgaatctcgctttatcaacggcagc
gagtatcggatcgacaatgcgcagatgatcatgggcattgcctga

DBGET integrated database retrieval system