KEGG   Paraburkholderia fungorum: OI25_4807Help
Entry
OI25_4807         CDS       T03799                                 

Gene name
pdxA
Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
bfn  Paraburkholderia fungorum
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OI25_4807 (pdxA)
Enzymes [BR:bfn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     OI25_4807 (pdxA)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     OI25_4807 (pdxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA Spore_YtrH
Motif
Other DBs
NCBI-ProteinID: AJZ62537
Position
2:complement(932245..933255)
Genome map
AA seq 336 aa AA seqDB search
MTYRPVIGITMGDAAGVGPEIVMKALAHASVYEQCRPLVIGDAARLRDAGQRAGVALEVR
SIDSPADAGFECGVVDCIDLGLIPADLPYGKLSAIAGDAAYQYIARTVKLTSAGELDAIC
TAPLNKEALHAGGHIFPGHTEMLAHLTGIDEVSMMLVAPKLRVIHVTTHIGLLDAIRRIE
PGLVQRTIERAHETLVRAGIDNPRIGVCGINPHAGENGLFGYGEEEEKIIPAVQVLQARG
WDVEGPLPADTLFFRAGRGDFDVVVAMYHDQGHGPVKVMGLEAGVNVTVGLPVIRTSVDH
GTAFDIAGKGIADERSMLEALKQALDLATRHSEQEA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcgtccagttatcggcatcaccatgggcgatgctgccggcgtcggccccgaa
atcgtcatgaaggcgctggcccatgcctccgtctacgaacagtgccgaccgctcgtgatc
ggcgacgccgcgcgtttgcgcgatgcgggccagcgcgcgggcgtcgcgctcgaagtgcgc
tcgatcgacagtcccgcggacgccggcttcgagtgcggcgtggtcgattgcatcgatctc
ggcctgattccggcggatctgccatacggcaagctctcggccatcgcgggcgatgcggcg
tatcagtacattgcgcgcacggtcaaactgacctcggccggcgaactggacgcgatctgc
acggcgccgctgaacaaggaagcgctgcacgcaggcggccacattttccccgggcatacg
gagatgctcgcgcatctgacgggtatcgacgaagtgtctatgatgctcgtcgcgccgaag
ctgcgtgtgattcacgtgacgacgcacatcggcctgctcgatgcgattcggcgcattgaa
ccgggactcgtgcaacggaccatcgagcgcgcgcatgaaacgctggtgcgcgccgggatc
gacaacccgcgcatcggcgtctgcgggatcaatccgcatgcgggcgagaacggcttgttc
ggctacggcgaggaagaggaaaagatcattccggcggtgcaggtgctgcaggcgcgcggc
tgggacgtcgaaggcccgttgcccgccgacacgctgtttttccgcgccggccgcggtgac
ttcgatgtggtggtcgcgatgtatcacgaccagggccacggtccggtcaaggtgatgggc
ctcgaggccggcgtcaacgtgactgtcggtctgccggtgatccgcacctcggtcgatcac
gggacggccttcgacatcgccggcaaggggatcgccgacgaacgcagcatgctcgaggcg
ctgaagcaggcactcgatctcgcgacgcggcactccgagcaggaagcctga

DBGET integrated database retrieval system