KEGG   Paraburkholderia fungorum: OI25_5013Help
Entry
OI25_5013         CDS       T03799                                 

Definition
(GenBank) gamma-glutamyltranspeptidase family protein
  KO
K22602  oxamate amidohydrolase [EC:3.5.1.126]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00230  Purine metabolism
bfn01100  Metabolic pathways
bfn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    OI25_5013
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bfn01002]
    OI25_5013
Enzymes [BR:bfn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.126  oxamate amidohydrolase
     OI25_5013
Peptidases and inhibitors [BR:bfn01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   OI25_5013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AJZ61268
Position
2:1155671..1157290
Genome map
AA seq 539 aa AA seqDB search
MSAEFLNPVRGIRGMAVTPHALASQSALAILRDGGNAVEAMIAAAATIAAVYPHMNSIGG
DGFWLISRPGEEPVGIEACGAAASAATIDAYRARGLQSIPFRGPLAANTVAGTVSGWALA
HQWSTDTLGGKLPVARLLEDAIAYAGGGIPVTRSQSECVALKRQELESVAGFAQTFLTGD
DPSGVPAVGDRFVQPRLAATLERLAHAGLDDFYRGDLARSIAADLRALESPLSLADLERH
RARLRTPLALTHSLGTIYNMPPPTQGLVSLQILGVLDRVLRDDMDPLGPEYVHACVEATK
LAFAIRDKHITDPDYMDIDPQALLAPPVLDAMAERISMSAAAPWGRGLGPADTVWLGVID
ADGVAVSFIQSIYHEFGSGLVLADSGINWQNRGCSFSLDPSARNPLTPGRRPFHTLNPAL
ARFNDGRTMVYGNMGGDGQPQSQSAVFSRIAHFGWNPQAAIDAPRWLLGRTWGRSNESLK
LEARFPANTFNVLRRLGHEVEQMRPYDEAMGHAGAIVRHGNGCLEAGFDPRSDGAAAGW
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagaatttttaaatccggtgcggggcatccgcgggatggcggtgacaccccat
gcgctggcgtcgcaaagcgcgctcgcgatcctgcgcgacggcggcaatgccgtcgaggcg
atgattgccgccgcggcgaccatcgcagcggtgtatccgcatatgaacagcatcggcggc
gacggcttctggttgatttcgcggccgggcgaagagccggtcggcatcgaggcatgtgga
gcggcggcatcagcggcgacgatcgacgcctatcgcgcacgcggcctgcaatcgattccg
tttcgcggaccgctggcggcgaatacggtggccggcacagtgtcgggttgggcgttggcg
catcagtggtccactgacacgctcggcggcaagctgccggtcgcacggctgctggaagac
gcgatcgcctacgcaggcggcggtattccagtcacgcgcagtcagtccgaatgcgtcgcg
ctcaaacggcaggaactcgaatcggtcgcggggttcgcacagacgtttctgacgggtgac
gacccgtccggcgtgccggctgtcggcgaccgctttgtccagccgcgcctcgccgcgaca
ctcgagcgcctcgcccacgcgggtctcgacgacttctaccggggcgacctcgcccgcagc
atcgcggccgacctgcgcgccctcgaaagtccgctgtcgctagccgacctcgaacggcat
cgcgcaaggctgcgcacgccgctggcactcacgcattcgctcggcacgatctacaacatg
ccgccgcccacacaagggcttgtctcgctgcagattctcggtgtgcttgaccgtgtcttg
cgcgacgatatggatccgctcggcccggagtacgtccacgcgtgcgtggaggcaaccaag
ctcgcgttcgccatccgcgacaagcacatcaccgacccggattacatggacatcgatccg
caggcgttgcttgcgccgcctgtgctcgacgccatggccgagcggatttcgatgtccgcg
gcggccccgtggggtcgcggtctcggaccggccgacacagtatggctcggcgtgatcgac
gccgacggcgtagccgtcagcttcatccagagcatctatcacgagttcggcagcggcctc
gtgcttgcggattcgggcatcaactggcaaaaccgcggctgtagcttctcgctcgatccg
tctgcgcgcaatccgctaacgccgggacgacggccgtttcacacgctgaacccggcactc
gcgcgcttcaatgacggacgcacgatggtgtacggaaacatgggcggcgacggccagccc
caatcgcaaagcgccgtgttttcgcgcatcgcgcatttcggctggaatccgcaagccgcg
atcgatgcgcctcgctggctgctgggccggacctgggggcgaagcaatgaatcactcaag
ctcgaggcgcggtttcccgccaatacattcaacgtgctgcgccgtctcggccatgaagtc
gaacagatgcggccatacgacgaagcaatgggccacgccggcgcgattgtccggcacggc
aacggatgtctggaggcaggcttcgacccgcgcagcgacggagccgcggctggctggtag

DBGET integrated database retrieval system