KEGG   Paraburkholderia fungorum: OI25_7055Help
Entry
OI25_7055         CDS       T03799                                 

Gene name
gnd
Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bfn  Paraburkholderia fungorum
Pathway
bfn00030  Pentose phosphate pathway
bfn00480  Glutathione metabolism
bfn01100  Metabolic pathways
bfn01110  Biosynthesis of secondary metabolites
bfn01120  Microbial metabolism in diverse environments
bfn01130  Biosynthesis of antibiotics
bfn01200  Carbon metabolism
Module
bfn_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bfn_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OI25_7055 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    OI25_7055 (gnd)
Enzymes [BR:bfn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     OI25_7055 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     OI25_7055 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD F420_oxidored 2-Hacid_dh_C TrkA_N NAD_binding_11 Sacchrp_dh_NADP GFO_IDH_MocA PDH 3HCDH_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AJZ62014
UniProt: A0A0D5VJF3
Position
2:3450242..3451279
Genome map
AA seq 345 aa AA seqDB search
MQLGMIGLGRMGADMVRRLTKGGQQCIAYDVQPAAVDKLKQEGVAGAASLEDLVAQLQKP
RAVWLMVPAAVVDQTLDKLVPLLEPGDIVIDGGNSYYHDDIRRGAELAKRQLHYVDVGTS
GGVAGRERGYCLMIGGEAEVVKRLEPIFSTLAPGAGAAPATPGRAAGASTADQGFLHCGP
QGAGHFVKMVHNGIEYGMMAAYAEGLNILRHADAGKHAREADAETSPLRRPELYQYDLDL
AEVAEVWRRGSVIGSWLLDLIAGSLAGDADLQSYAGRVSDSGEGRWTVAAAIDEGVPTPV
LSAALFARFSSRGDADFANRVLSAMRHDFGGHVEKAATPVDGHKS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcagctaggcatgattggattgggacgcatgggcgcggacatggtgcgccgcctgacg
aagggcggtcagcaatgcatcgcttacgacgtacagccggccgcagtggacaagctgaag
caggaaggcgtggcaggtgccgcgtcgcttgaagatctggtcgcgcaattgcaaaaaccg
cgcgcggtgtggctgatggtgcccgccgcggtggtcgaccagacgctcgacaagctcgtg
cccttgctcgaacccggcgacatcgtgatcgacggcggcaactcctattaccacgacgac
attcgccgcggcgccgaactggcgaagcgtcagcttcactatgtcgacgtcggcaccagc
ggcggcgtcgcgggacgtgagcgcggctactgtctgatgatcggcggcgaggccgaagtc
gtgaagcggctcgagccgattttctcgaccctcgcgccgggtgcgggcgccgcgcccgcc
acgccgggccgcgcagccggcgccagcaccgcggatcagggcttcctgcattgcggcccg
cagggcgcggggcactttgtgaagatggttcacaacggtatcgaatacggcatgatggcc
gcgtatgccgaaggcctgaacattctgcgccatgccgacgccggcaaacacgcgcgcgaa
gccgatgccgaaacatcgccgctgcgccgtcccgagctttaccaatacgacctggatctc
gccgaggtcgccgaggtctggcggcgcggcagcgtgatcggttcgtggctgttggacctg
atagcgggatcgctggccggcgacgccgatctgcaaagctatgcaggacgcgtatcagat
tcgggcgaagggcgctggaccgtcgcggcggcaatcgacgaaggcgtgccgacaccggtg
ctgagcgccgcgctattcgcgcgtttcagttcgcggggtgacgcggactttgcgaaccgg
gtgttatcggcgatgcggcacgacttcggcggccacgttgaaaaagcggccacgccggtc
gacgggcataagagctaa

DBGET integrated database retrieval system