KEGG   Branchiostoma floridae (Florida lancelet): 118411425
Entry
118411425         CDS       T01074                                 

Definition
(RefSeq) deoxycytidine kinase-like isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00230  Purine metabolism
bfo00240  Pyrimidine metabolism
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    118411425
   00240 Pyrimidine metabolism
    118411425
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     118411425
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_17
Other DBs
NCBI-GeneID: 118411425
NCBI-ProteinID: XP_035669597
Position
3
AA seq 253 aa
MATEAKKARLNRIKRVAVEGNIAVGKSTFISLLEEESSDWAIVGEPLSRWQNVQCHSERD
EEITLSQKHGGNLLDMFYSDPRRWAFTFQSYVCLSRMRHQLKPAPGHLETAAEPVVFYER
SVYSDRYCFAANCFSLGTFNETEWNIYCDWHSTMMAAMGELKLDGIIYLRAEPEVCLERL
KLRGRPEERPVSLEYLDQIHTRHESWLVHKEISVSDSLKGAPILTMDCNLSFQEDTDKQN
DMMSQVKAFVAGL
NT seq 762 nt   +upstreamnt  +downstreamnt
atggcgacagaagcgaagaaagctcgtctgaaccggatcaaaagggtcgctgtggagggg
aatatcgcggtggggaagtcgaccttcatctccctgctagaggaggagtcttctgattgg
gcgatcgtcggcgagccgctgtcccgctggcagaacgtgcagtgccacagcgagagggac
gaggaaatcaccctgtcccagaagcacggagggaacctgctggacatgttctactccgac
cctcgccgctgggcgttcactttccagtcatacgtctgcctgagccgtatgaggcaccag
ctcaaaccggcaccgggccacctcgaaactgccgccgaacccgtcgtcttctatgagcgc
tccgtctacagtgacaggtactgttttgctgccaactgtttttctctgggcacgtttaac
gagacggagtggaacatctactgtgactggcactccaccatgatggccgccatgggcgag
ctgaaactggacgggatcatctacctcagggctgagccagaggtgtgtctggagagactt
aagctgcgaggtcggcctgaggagcgtcctgtctccctggagtatctggatcagatccac
acccgacacgagtcctggctggtgcataaggagatcagtgtttcagacagtctcaagggg
gcgccgatcctgaccatggactgtaacctgagtttccaggaagacacagacaaacagaac
gacatgatgtcacaggtgaaggcctttgttgcagggctgtag

DBGET integrated database retrieval system