KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_102103Help
Entry
BRAFLDRAFT_102103 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00564  Glycerophospholipid metabolism
bfo00565  Ether lipid metabolism
bfo00590  Arachidonic acid metabolism
bfo00591  Linoleic acid metabolism
bfo00592  alpha-Linolenic acid metabolism
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BRAFLDRAFT_102103
   00565 Ether lipid metabolism
    BRAFLDRAFT_102103
   00590 Arachidonic acid metabolism
    BRAFLDRAFT_102103
   00591 Linoleic acid metabolism
    BRAFLDRAFT_102103
   00592 alpha-Linolenic acid metabolism
    BRAFLDRAFT_102103
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     BRAFLDRAFT_102103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 7254714
NCBI-ProteinID: XP_002586982
JGI: 102103
UniProt: C3ZWS4
AA seq 167 aa AA seqDB search
ELLLAEKWARINGVPFPPIDTSVFDREGMKECYVFKHPTDEKCPIVIHFVLVNIEFRKFS
KPGVKRETEEELEFANFDLFDDPNTPFSTFNFCYPHKAFDRLAQLMEFNTLLSLDIIKDN
IAEWVQRRRRGGPRPNLDLADVKRNSFKNSKKKLRQLIRTFSIDSDT
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gaactgctgctagccgagaagtgggcccgtataaacggagtcccgttcccgcccatagac
accagcgtgtttgaccgagaagggatgaaggagtgttacgtcttcaagcaccccacagac
gagaagtgccccatcgtcatccacttcgttctcgtcaacatcgagttcaggaagttctca
aaacccggtgtaaaaagagagacagaagaggagctggagttcgcgaactttgacctgttc
gatgacccgaacacgcccttctcgacctttaacttctgctacccgcacaaggcgtttgac
aggctggcgcagctcatggagttcaacacgctgctcagtctggatatcatcaaagacaac
atagcggagtgggtacagcgcaggcgcagaggaggccccaggccgaaccttgacctcgct
gacgtcaagagaaactccttcaagaattccaagaagaaacttcgacagctgatcagaact
ttctccatcgactcggacacgtga

DBGET integrated database retrieval system