KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_108415Help
Entry
BRAFLDRAFT_108415 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00561  Glycerolipid metabolism
bfo01100  Metabolic pathways
Module
bfo_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BRAFLDRAFT_108415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bfo01002]
    BRAFLDRAFT_108415
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     BRAFLDRAFT_108415
Peptidases [BR:bfo01002]
 Serine Peptidases
  Family S33
   BRAFLDRAFT_108415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase DUF900
Motif
Other DBs
NCBI-GeneID: 7229927
NCBI-ProteinID: XP_002592549
JGI: 108415
UniProt: C3ZFS2
AA seq 171 aa AA seqDB search
MSAKFASNIRAFRSSLLRIPWALVFLSHGYKQNCLQYDEFAKQMTSYGLKVFAHDHVGHG
QSQGYCADVTSFDVFVEDVIQHVCQVRQQHPGIPVFAVAHSMGALITILAALKRPGLFAG
VVCTGAALRINGIPTGWKLLCLKVLAYFFPLGIVPGTGEAGGTPTTRYTEE
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaagttcgccagcaacatccgggcattccggtcttcgctgttgcgcattcca
tgggctctcgtatttctgtcacacggctacaagcagaactgtctacaatatgacgagttt
gctaaacaaatgacgtcatatggactcaaggtgttcgctcacgatcacgttggtcacgga
cagagccagggctattgcgctgacgtcacgtcttttgacgtctttgttgaagacgtcatc
caacatgtctgccaagttcgccagcaacatccgggcattccggtcttcgctgttgcgcat
tccatgggggcgctcatcaccatcctggcggccctcaaacgtcccggtctgttcgctggg
gtcgtctgtaccggtgctgctctcagaatcaacgggattccaactggctggaaactcttg
tgtttgaaggttctggcgtacttctttccattgggtattgtaccaggcacgggagaagcc
ggcgggactccgacgaccagatacactgaagag

DBGET integrated database retrieval system