KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_108680Help
Entry
BRAFLDRAFT_108680 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00510  N-Glycan biosynthesis
bfo00514  Other types of O-glycan biosynthesis
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    BRAFLDRAFT_108680
   00514 Other types of O-glycan biosynthesis
    BRAFLDRAFT_108680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bfo01003]
    BRAFLDRAFT_108680
Enzymes [BR:bfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     BRAFLDRAFT_108680
Glycosyltransferases [BR:bfo01003]
 Terminal extension
  Sialyltransferase
   BRAFLDRAFT_108680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 7237955
NCBI-ProteinID: XP_002602812
JGI: 108680
UniProt: C3YLQ5
AA seq 319 aa AA seqDB search
MMFRRGIFFCGILLCGCITFYAILDMLLIASTFNSAKYLHKLKRELPCQLKRNVPFSTIT
REQASKDGNKTVLPEYSLENMVHFNSCAVVSSSHTLRFHTYGQEIDSHDAVLRFNCAPTD
KFEKFVGNRTDFRLINTRIPEKSCTDEFWSDNSTMFKHETIIIRNLDAINLKRQTINVKH
DRYRAFANLIKYRKTYPNRTLPFIQRPKFGHAILTELQRFCVTSRMCAKSRLSPSSGMLG
VVMMMHLCDWVHVYELVPSNKDDTKLVYYFDEKKTWPARREHSYGQERAYVKTLSMTPEN
DIEESGVVLLKGLSQTPCV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttcggcggggcatttttttctgtggtattcttctctgcggctgtatcaccttc
tacgctattttggacatgctcctgatagcaagtacgttcaacagtgccaaatatcttcac
aaattgaagcgggaattgccgtgccagctgaagaggaacgtgccgttttctaccataaca
agagagcaggcgtccaaagatggaaacaagaccgtcctgccagagtatagtctggagaac
atggtgcactttaactcgtgtgcagtcgtcagtagtagccacacactgaggtttcatact
tacggacaggaaatagacagtcacgacgccgtgctaaggttcaattgtgcacccaccgac
aagtttgagaagttcgtcggaaaccggacggactttcgtctcatcaacacaagaatccct
gaaaaaagctgcacggatgagttctggagcgacaacagtaccatgttcaaacatgaaacc
ataatcatacggaatttagacgcgatcaacttgaaacggcaaaccatcaatgttaaacac
gaccgttaccgggcttttgctaacttgattaagtacaggaagacatatcccaaccggact
ctgccttttatacagaggcctaaattcgggcatgccatcttgacagaattgcagcggttc
tgtgtcacttcgagaatgtgtgcaaagtcaagattgagtccaagttcaggcatgcttggt
gttgtgatgatgatgcacctctgtgactgggtgcatgtctacgagctcgttccgtccaac
aaggatgacaccaaacttgtctattacttcgacgagaagaaaacgtggcctgcacgccgt
gagcactcgtatggccaggaaagggcttacgtcaagactttgtcgatgactcccgaaaat
gacatagaagaaagcggcgtggtgcttctgaaaggactgtcacagactccctgcgtttaa

DBGET integrated database retrieval system