KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_117612Help
Entry
BRAFLDRAFT_117612 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01587  phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00230  Purine metabolism
bfo01100  Metabolic pathways
Module
bfo_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BRAFLDRAFT_117612
Enzymes [BR:bfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     BRAFLDRAFT_117612
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     BRAFLDRAFT_117612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAICAR_synt AIRC
Motif
Other DBs
NCBI-GeneID: 7213409
NCBI-ProteinID: XP_002594170
JGI: 117612
UniProt: C3ZBE4
AA seq 419 aa AA seqDB search
MAGLKLGDKIIEGKTKIVYALPDDPANVYILSKDRITAGDGARANDLEGKAVISTATATS
IFDLLTSAGIKNHFVRQHDDKSFIAQRCDMIPIEWVTRRLATGSFLKRNVGVKEGYRFSP
PKLETFFKDDENHDPQWSYEQLLGAKLEAGGRVIGRDEVEIMSRTTVAVFEVLEKAWATQ
NCTLVDMKIEFGVNTKGEIVLADLIDSDSWRLWPSGDRRLMKDKQVYRELKEVTAEALDE
VKRNFQWVAERVKLLQTKPSAQVVVLMGSATDLEHGQKISKGCQALGIPCDVRVSSAHKG
TEETIRILREYEGEGIPCVFVAIAGRSNGLGPVLSGNTSYPVINCPPVKADWGAQDIWSS
LRLPSGLGCSTVLSPDAAVLAAAQILSLSDHMIWSRLRCKQLYTYLGLKDSDKEVRKDK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcaggactaaagcttggagacaagatcatcgaaggcaagaccaagatcgtctatgcc
ctccccgacgacccggcgaatgtctacatcctgtctaaggaccgcatcactgccggagat
ggcgcacgtgcaaacgacttggagggcaaggccgtcatctccacggcaaccgcaacttcc
atcttcgatctgctgaccagcgcaggtataaagaaccactttgtacggcaacatgacgac
aagtccttcatcgcccagcgctgtgacatgattcccatcgagtgggtcacacgacgattg
gctaccggctccttcttaaaacgaaatgtcggagttaaagaagggtacaggttctctcca
cccaagctggagactttcttcaaggatgatgagaaccatgatcctcagtggtcgtacgaa
cagctgctcggagccaagctggaggcagggggccgcgtgattggtcgagacgaggtggag
atcatgagccggacgacggtggccgtgttcgaggttctggagaaggcctgggccacgcag
aactgcacgctggtcgacatgaagatcgagtttggtgtcaacacgaaaggtgagattgtg
cttgctgacctgattgacagcgactcgtggcggctgtggccgtcaggtgaccgccggctg
atgaaagataagcaggtgtaccgcgagctgaaggaggtgacagcagaggctctggacgag
gtgaagaggaacttccagtgggtcgccgagagggtcaagctgctgcagaccaagcccagt
gcccaggtggtcgtgctgatggggtcagccacggacttggagcacgggcagaagatcagt
aaagggtgccaggcactgggcattccctgcgacgtcagggtcagctctgcacacaagggc
accgaggagaccatcaggatcctaagggagtatgaaggagaaggtatcccgtgcgtgttt
gtcgccatcgcggggcgcagtaacgggctgggaccagtcctgtctggtaacacgtcctac
ccggtcatcaactgcccccctgtgaaggccgactggggagcccaggacatctggtcctct
ctcaggctgccgtcaggtcttggctgttcgaccgtgctgtcccccgacgcggctgtcctg
gcggctgcccagatcctgtcgctgtccgatcacatgatctggtcccgcctgcgctgcaag
cagctgtacacctacctcgggctcaaggactctgacaaggaagtccgcaaggacaagtaa

DBGET integrated database retrieval system