KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_119698Help
Entry
BRAFLDRAFT_119698 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bfo01002]
    BRAFLDRAFT_119698
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bfo03110]
    BRAFLDRAFT_119698
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     BRAFLDRAFT_119698
Peptidases and inhibitors [BR:bfo01002]
 Serine peptidases
  Family S8: subtilisin family
   BRAFLDRAFT_119698
Chaperones and folding catalysts [BR:bfo03110]
 Intramolecular chaperones
  Subtilisin family
   BRAFLDRAFT_119698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N Antiterm
Motif
Other DBs
NCBI-GeneID: 7225611
NCBI-ProteinID: XP_002603314
JGI: 119698
UniProt: C3YJL8
AA seq 1216 aa AA seqDB search
MAAIVDHEFPIHGLLPKRETGASAFLAKYPEYDGRGVTIAILDTGVDPGAPGLQQTSDGR
PKIVDIIDTTGSGDVDVSTVVEPKDGEIVGLSGRTLKVPASWENPTGRYHIGVKNMYELF
PKQLRDRTQKDKKEKTWDPPHRVALAEAIRKLDEFDTAHPNPTAQDEKLQREDLQAQLDI
LTSQEKKYSDPGPVCDCLVWHDGNTWRAVLDTSETGDLESCTVLASYREQHQFCIFSLFV
MFNYSVNIYDDGKVLNICANGGAHGTHVACIAAGNFPDDPERNGIAPGAQIVAIKIGDSR
LSTMETGSALIRAMIAVIDQKCDLVNFSYGEAAHWPDKGRVCDIISEAVNKHGVIFVSSA
GNNGPALTSVGTPGGTTSSIIGVGAFVSPEMMTAEYSLREKLPSNQYTWSSRGPTIDGAL
GVSISAPGGAIASVPNWTLRGSQLMNGTSMSSPNACGGIALVLSALKATGVPYTPYTVKT
ALENTAQKVEGVEVFAQGHGVLQVEKAFDHIRQHADSAERNVRFSVAVNGGRGVHLRQAL
SQRKPTEMTVSIEPVYAEDIEANEKISLSIHVSLVSEVPWVHVPPCLELMNTPRTFVIKV
DPRGLREGAHYTEVLGYDISNPQKGPLFRVPVTVVRPESVQDKVQYKVTSEREVTFKPGQ
VHRRFIDVPLGATWAEVTIQSLSPETVGRFILHMVQLQPHSAYRTHESYKFFNLTELGEV
SYTCPVLEGVTVEVCLARWWASLGEVNVNYNVTFHGLQPSVTTLNLHAADGITRVDVKSP
LKHEDVQPSIKLEHGVCPLRPSEFKIRPLGDRDVLPPNRPSYELVLTYNYHQTKTCEVMP
HCPTLSGLNLDTYNFKLEKGDYTIKLQIRHETKDLLEKLKDVTFLVQYKLPSALSLDVYP
SKSNALLGKAKFGTQRCGIGVTAPMFITPLPDDKVPKAASPGHYLVGQISYAKAEPGKKT
ATYPVHYVISAAPCKPKNGGKDKDKKEDKDPQEEFNEALRDFKIQWMSKLDSKAIYQELK
ELHPNHLPLHVGLLQALDNDKERLKQLDDIIAAADVVIGQVDMAELASFLALKADTRSDA
ATIKVEMEKKKATLIDAVCKKGNAAADKVLQALDGDAVGSTEIVKDLALVKETFEELLKW
AEPMDIKVVSFTMKHAMVCGQYGRAIKAAQKILDDKPNKENEKKCIELYKKIGWDHVAKH
CERWLPVRYPQSYTLF
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatcgtcgaccacgaattcccgattcacggccttctaccgaaaagagagacc
ggcgcttcggctttcctcgccaaatatcccgagtatgacggcaggggagtcaccattgct
atcctggacacaggagtggacccaggagcgccaggcttacagcaaacctcagatgggagg
ccaaagatcgtggatatcatcgacaccacggggagcggagatgtggacgtgtcaactgtc
gtggagccaaaagatggggagattgtgggactgtcggggcgaacccttaaggtcccagct
agttgggagaatccaaccggccgttaccacataggggtgaagaacatgtatgagctcttc
cctaaacaactcagagacaggactcagaaagacaagaaagagaagacctgggaccctcca
cacagggtggctctggctgaggcaatcaggaaactggatgagtttgatacagcacacccc
aaccctacagcacaggatgagaagctccagagagaagacctccaggcccaactggacatc
ctgaccagtcaggagaagaagtactcggaccctggtcctgtgtgcgactgtctggtctgg
cacgatgggaacacatggagggctgtgttagacaccagtgagacaggagacctggagtcg
tgtacagtactggccagctacagagaacagcaccagttttgtatctttagtttgtttgtt
atgtttaactactctgtcaacatctacgacgatggaaaggttctcaacatatgtgccaat
ggaggagcccacggtacccacgtggcgtgtatagccgcgggaaacttcccagatgacccg
gagaggaacggaattgcgccgggagcgcagatcgttgccatcaagatcggagactcccgg
cttagtaccatggagactggctctgcacttataagagcgatgattgctgtaattgatcag
aagtgcgatctggtgaacttcagttatggggaagcggcacactggcctgacaagggtcga
gtgtgtgacatcatctcggaagctgtcaacaaacatggcgtcatcttcgtgtccagcgcc
gggaacaacggccccgccctgacgagtgtcggaactccgggcggaacgacctccagtatc
attggtgtcggtgccttcgtgtctccagagatgatgacagctgaatactctctcagggaa
aagttacctagcaaccaatacacctggtcgtcaaggggaccaactatagacggagcctta
ggtgtgagtatttccgcgccaggtggcgctatagcctccgtgcctaactggacgctccgc
ggctcacagctaatgaacgggacgtccatgtcttcaccaaacgcctgcgggggcatcgct
cttgtactgtctgcgctgaaggcgacgggtgtaccctacaccccctacactgtgaagact
gcactagagaacacagcacagaaggtggaaggggtggaggtgttcgctcagggacatggg
gtgctacaggtggagaaggcttttgaccacatccgtcaacatgccgactcagcggagaga
aacgtgcggttctctgtagcggtgaacggtgggaggggggtgcacctcagacaggccttg
tcacagaggaaacctaccgagatgactgtcagtatagaacctgtgtatgctgaggacata
gaggccaatgagaagatatctctctccatccatgtgagcctggtgagtgaggttccatgg
gtacatgtgccgccatgtttggaactcatgaacaccccaaggacgtttgtcatcaaggtc
gacccaaggggactcagggaaggagctcactatactgaggttttaggctatgacatcagt
aacccccagaagggccccctgttcagagtgcctgtgacagtagtgcgaccagagagtgta
caagacaaggtccagtacaaggtgacctctgagagagaagtgaccttcaaacctggacag
gtacacaggaggttcattgacgtgcctctgggagccacgtgggcagaggttaccatccaa
tccctgtccccagagacagtggggaggttcattctccacatggtacagctacagccacac
tctgcctacaggacgcacgagtcctacaagttcttcaaccttacagagctgggggaggtc
tcctatacctgccctgtgttggagggagtgacagtagaagtgtgcctagcacgttggtgg
gcaagtcttggggaggtcaatgtcaactacaacgtcacctttcatgggttacagccaagt
gtcactacactcaatctgcatgcagcggacggtatcaccagggtggacgttaagtctcca
ctgaagcacgaggatgtccaaccaagcatcaaactggagcatggtgtatgtccgctcagg
ccgtccgagtttaagatccgccccctgggtgacagggacgtactgcctcccaaccgacca
tcgtatgagctggtgctgacatataactaccatcagactaagacttgtgaggtgatgccc
cactgcccgaccctatctggcttaaatttggacacgtacaacttcaaacttgagaaggga
gactataccattaagctacagataaggcatgagactaaggacctcctggagaaactgaag
gacgtgaccttcctggtgcaatacaaactgcccagcgccctgtcgttggacgtctacccg
tccaagtccaacgctctgctgggcaaggccaagttcgggacacagcgatgtggtataggg
gtgacggcaccgatgttcatcacccctctacctgacgacaaggtcccaaaggctgctagt
ccaggacactacctggtagggcagatctcttacgccaaggccgagcctggcaagaaaact
gccacctacccagtgcactacgtgatatcagctgccccctgtaagcccaagaacggtggg
aaagacaaggacaagaaggaagacaaggacccccaggaggagtttaatgaggctctcagg
gatttcaagatacagtggatgtcaaagcttgacagcaaggccatctatcaggagttgaag
gaactgcaccccaaccacctacccttacatgtaggactactgcaggctctggataatgac
aaggagagattgaaacagctggatgacatcatcgcggctgcagacgttgtgattggtcag
gtggacatggccgaactggcgagctttctcgccctgaaggctgacacgcgatcagacgca
gcgaccatcaaagttgagatggaaaagaagaaggcaaccctgatcgacgctgtgtgcaag
aagggaaatgcagcggctgacaaggttctgcaggcactggatggagacgcagtgggcagc
acagaaatagtgaaggacctcgcacttgtgaaggaaacgtttgaggagctgctgaaatgg
gcagaaccaatggacatcaaggtggtcagttttaccatgaaacatgccatggtgtgtggt
cagtatggcagggccatcaaggcagcacagaagatcctggatgacaaacctaacaaggaa
aacgagaagaagtgtatagagctttacaagaagattggttgggaccacgtggccaaacac
tgcgagcgctggctgcccgtcagatacccacaatcctacacacttttctag

DBGET integrated database retrieval system