KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_120055Help
Entry
BRAFLDRAFT_120055 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K17095  annexin A7/11
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bfo04147]
    BRAFLDRAFT_120055
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BRAFLDRAFT_120055
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_120055
  Exosomal proteins of colorectal cancer cells
   BRAFLDRAFT_120055
  Exosomal proteins of bladder cancer cells
   BRAFLDRAFT_120055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin Plk4_PB1
Motif
Other DBs
NCBI-GeneID: 7226443
NCBI-ProteinID: XP_002610358
JGI: 120055
UniProt: C3Y002
AA seq 325 aa AA seqDB search
MSLGGWQPGQTRGTVVPTENFDAEEDAKILRKAMKGMGTDEKAILELLAERSNAQRQKIK
LQFKTMYGKDLISDLKSELSGDFKESVMALFVPTTEYDAWCLNNAMVGLGTNEEVLIEIL
CTRTNEEIAEIVRVYRDKFHRDLEKDVVGDTSGHFKRLLVSMTTANRDEVKEVDLEKAKK
EAKELYKAGEKKWGTDESEFNRILACRSFPQLKATFDEYIKVSQRDIMGTIDREFSGHVR
DGMKAIVMCVRNRPEFFADKIYKCVKGLGTDDHTLIRVIVTRSEYDMVEIKQVFLNKYRK
TVWKAIDSDTSGDYKRILQALVKKD
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcgggggctggcagcctggccagacccgcggcaccgtcgtccctacggaaaac
ttcgacgctgaggaggacgctaagatcctacgcaaggccatgaagggaatgggaactgat
gagaaggccatcctggagctgttggctgagcgcagtaacgcccagcgacagaagatcaag
ctgcagttcaagaccatgtatggcaaggacctgatctcggacctgaagtctgagctgagc
ggagactttaaggagagtgtgatggcgttgttcgtccccactacggagtacgacgcctgg
tgcctcaacaacgccatggtgggcctgggcaccaatgaggaggtgttgattgagatcctg
tgcactcgaaccaacgaggagatcgcagagatagtcagggtctaccgcgacaaattccac
cgcgacctggagaaagacgtcgttggggacacaagcggacacttcaagcgtttgcttgtc
tccatgacaacggctaaccgagacgaggtgaaggaggttgaccttgagaaggctaagaag
gaggctaaggagctgtacaaggcgggagagaagaagtggggaacggacgagtcggagttc
aaccgtatcctcgcctgtcgcagcttcccacagctcaaggctacgtttgacgaatacatc
aaggtctcccagcgtgacattatgggcacaatcgaccgtgaattctctggacatgtgcgt
gatgggatgaaggctattgtcatgtgcgtgcgaaaccgcccagagttctttgctgacaag
atctacaagtgtgtgaaggggctgggcaccgacgatcacaccctgatccgggtcattgtc
actcgcagtgagtatgacatggtggagatcaagcaggtgttcctgaacaagtacaggaag
acggtgtggaaggccatcgactctgacaccagcggagactacaaacgcatcctgcaggca
ctcgtcaagaaggactga

DBGET integrated database retrieval system