KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_121595Help
Entry
BRAFLDRAFT_121595 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00480  Glutathione metabolism
bfo00590  Arachidonic acid metabolism
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BRAFLDRAFT_121595
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BRAFLDRAFT_121595
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BRAFLDRAFT_121595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 7211964
NCBI-ProteinID: XP_002596445
JGI: 121595
UniProt: C3Z4T5
AA seq 215 aa AA seqDB search
MGLSSGLLASLLCLGFLGPGLANKRTEQCSCAAEQGSLHDHHAMLLDGSRNVSLAEYRGT
TLLVILGFPTNQFGLEEPARNDEILNGIRYVRPGNDYVPNFTMFQKGDCNGENEQSLFTY
LKSCCPPISDVMGIRGDKDRLYWKPLKVNDVRWNFEKFLVDPEGRGVKSCCPPISDVMGI
SGNKDRLYWKPLKVNDVRWNFEKFLVDPEGRGVKR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggggctctcctcgggcctcttggcctccctgttatgcctgggtttcctgggcccgggc
ttggctaacaagcggacggaacagtgtagctgtgcggccgagcaaggatccctccacgac
catcacgccatgctcctggacgggtctcgcaacgtcagcctggccgagtaccggggcacg
accctcctggtgatcctgggtttccccaccaaccagttcgggttagaagagccagcgaga
aatgacgagattctgaacgggataagatacgtccgtccggggaacgactacgtccctaac
ttcaccatgttccagaagggagactgcaacggggagaacgaacagtcgctcttcacttat
ctaaagagctgctgccctcccatctctgacgtcatgggcatcagaggcgacaaagacagg
ctatactggaaaccgctcaaggtcaacgacgtccgctggaacttcgagaagtttctggtg
gatccggaagggagaggagtcaagagctgctgccctcccatctctgacgtcatgggcatc
agcggcaacaaagacaggctatactggaaaccgctcaaggtcaacgacgtccgctggaac
ttcgagaagtttctggtggatccggaagggagaggagtcaagaggtaa

DBGET integrated database retrieval system