KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_123636Help
Entry
BRAFLDRAFT_123636 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K17890  autophagy-related protein 16-1
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04136  Autophagy - other
bfo04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    BRAFLDRAFT_123636
   04136 Autophagy - other
    BRAFLDRAFT_123636
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bfo04131]
    BRAFLDRAFT_123636
   03029 Mitochondrial biogenesis [BR:bfo03029]
    BRAFLDRAFT_123636
Membrane trafficking [BR:bfo04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    BRAFLDRAFT_123636
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    BRAFLDRAFT_123636
Mitochondrial biogenesis [BR:bfo03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    BRAFLDRAFT_123636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Nup160 Fez1 Tektin
Motif
Other DBs
NCBI-GeneID: 7233896
NCBI-ProteinID: XP_002593276
JGI: 123636
UniProt: C3ZEY1
AA seq 601 aa AA seqDB search
MAANGSEEGGWKQTLLLRLRDRNRVQTHFFADVIQAHNKLFESADTLKSQNVQLQLQTER
LKQDKLDLEVKVLDSSANSGTGKGEKTQALEQKLFKLQEELTELHRRKGENAQQIIDLNS
ALQEKEKVLSEKENRLLDTETHLEALKAECRNLEQAILEKDALHQALRDEHQALQMTFSA
LEDKLRKTQAENQDLVERWLQQKSRDADKMNFENDQMARKRQAKLQRELAEAAKEPSPPL
MDKMFNSSTSEAPVNPGHVGFIESIAGLLAGKKRSSSHDDGFEPQTSAAGAPPRHYVTVT
LPSTAIHKADGHDGEVNAVRFSPSGRIVATGGTDRKLKLWEIMNRKLDSKAVLTGSNAGI
MSVEFDPQENYILGASNDFASRVWSVADYRLRHTLTGHSGRVMAAKFLGDSSRVVSGSHD
RTLKIWDLRSRACIRTIFAGSSCNDLVTSDLSGTNIISGHFDKRIRFWDTRAESSANEIT
LQGKITSLDLSLDNKYLLSCSRDDSLKLIDLRMNQVTGTFCPDAQYVVAGSSDGSIFIWN
ITTFRLEKTLKEHNSSVIACSWHPSGMMMVSCDKNKKVTLWSDITLMEQAIGENRNENSC
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaacgggtctgaggaaggaggttggaaacaaacacttttactccgtctccga
gacagaaacagggtacagacacacttcttcgcagacgtcatacaggcccataacaaattg
tttgagagtgcagacaccctgaagtctcagaatgtccagctacaactgcaaacagagaga
ctgaaacaagacaaactagacctggaagtgaaagtcttagattcaagtgcaaattcagga
actggcaaaggagagaagacccaagcactggaacagaagctcttcaaactacaggaagaa
ctcactgagctacacagaagaaaaggagaaaatgcccagcagatcatcgacctgaacagt
gctctacaggagaaggagaaggtcctgtctgagaaggagaacagactgctggacacggaa
actcacctggaggctctgaaagctgaatgtcgaaacctggagcaggccattctggagaag
gatgctctgcaccaggcattacgagacgagcaccaggccttacagatgaccttcagtgcc
cttgaggacaagttgcggaagacgcaggccgagaaccaggacctcgtcgagagatggctg
cagcagaagtctagagacgccgacaaaatgaactttgaaaacgaccaaatggccagaaaa
agacaagccaaacttcagagagaattagcagaggctgccaaggaacccagccctccccta
atggacaagatgttcaactcgtccacatcggaggcccctgttaaccctggacatgttggc
tttattgaatccattgcaggattactggccggtaaaaaaaggtcgtcttcacatgatgac
ggtttcgaaccccagacctctgctgcaggagccccgccccggcactatgtcacagtcact
cttccttcaacggctattcacaaggcagatggccatgatggagaagtaaatgctgtccgc
ttcagcccttcagggagaatagtagccacaggagggacggacaggaaactcaaactgtgg
gaaatcatgaaccgtaaacttgactccaaagctgtcctaactggaagcaatgctggaatc
atgtcggtggagtttgatccacaggagaactacattcttggggcttctaatgactttgct
agtagagtttggagtgtagctgactacagattaagacacaccctgacaggtcacagtggg
agagtcatggcagccaagttcctgggagactccagcagagtggtgtcaggcagccatgac
aggacactcaagatctgggacctcaggagcagggcatgtatccgaaccatttttgcaggt
tccagctgtaatgacctggtgacctctgacctctcaggcacaaacatcattagcggccat
tttgacaagaggataagattttgggacaccagggcggaatccagtgccaatgagatcaca
ctacagggaaaaatcacttctctggatctatcactagacaataaatatctgctgagctgc
tcgagagacgactccctgaagctgatagacctgagaatgaatcaggtgacagggacattc
tgtcctgatgcccagtatgttgtagcagggtcgtcagacggtagtattttcatctggaac
atcacaaccttcagattagagaaaactctaaaggaacacaattcttcagtgatagcatgc
tcctggcaccccagtgggatgatgatggtcagctgtgataagaacaagaaagtgacgctg
tggtcagacataacattgatggagcaagcgattggggaaaatagaaatgaaaacagctgc
ctgtga

DBGET integrated database retrieval system