KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_144659Help
Entry
BRAFLDRAFT_144659 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bfo01001]
    BRAFLDRAFT_144659
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BRAFLDRAFT_144659
Protein kinases [BR:bfo01001]
 Serine/threonine kinases: STE group
  STE20 family
   BRAFLDRAFT_144659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 7227852
NCBI-ProteinID: XP_002593184
JGI: 144659
UniProt: C3ZEN9
AA seq 408 aa AA seqDB search
QGRHTKTGQLAAIKVMDKCSFLFQDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPG
KDDQLWLVMEYCGAGSVTDLVKATKGNSLKEEWIAYICREILRGLAHLHSCKVIHRDIKG
QNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDL
WSLGITALEMAESQPPLCDLHPMRALFLIPRNPPPRLKSKKWSKKFVSFVENCLVKNYHQ
RPSTEQLLKHPFIRDQPTERQVRIQLKDHIDRYVKKKKGSHTEEEEYKYSGSEGEEDPTL
EKEGEPSSVVQAPGESTLRKNFLKLQQENREREAARMRAEEERRRHEREREHQQRQLDER
RKRQKQHERQREMQRQQERLERHRVEKERQREGRGDRDRDRHRDRDRR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
cagggtcgccacaccaagactgggcagttggcggccatcaaagtcatggataaatgttct
ttcttgtttcaggatgaggaagaagagatcaaactagaaatcaacatgctgaagaagtat
tcccaccaccggaacatcgcgacttactacggcgccttcatcaagaaaagtccaccagga
aaggacgaccagctatggcttgtcatggaatattgtggagctggatcagtcacagactta
gtcaaagcaacaaaaggaaactcgctgaaggaagagtggatagcctacatctgcagagaa
attcttaggggactggcccacctgcacagctgtaaggtgatccacagagacatcaagggt
cagaacgtcctgctgacggacaacgcagaggtcaaactagttgatttcggagtgagcgcc
cagttagaccggactataggcaggagaaacaccttcatcggcacaccgtactggatggcg
ccggaggtcatcgcttgtgatgagaacccagatgctacttacgactacaggagtgacctg
tggtccctcggtatcacagcactcgaaatggcggagtcacagccacctctatgtgatctt
caccccatgagggctttattcctaattccaaggaaccctcctccaagattaaaatccaag
aaatggagcaagaagtttgtaagtttcgtagaaaattgcttggttaaaaattaccaccag
cggcccagcacggagcagttactgaagcaccccttcatacgagaccaacccacagagaga
caggtgagaatacaactgaaggaccacattgacagatatgtgaagaagaagaaggggagt
cacacagaggaagaggagtacaagtacagtgggagtgagggagaggaagatcccactctg
gagaaggagggagagccaagctctgtagtgcaggcaccaggcgagtccaccctcaggaag
aacttcctcaagctgcagcaggagaaccgggagcgggaggccgccaggatgcgggcggag
gaggagagacggagacacgagcgggagcgagagcaccagcagcggcaactggacgagaga
cggaaacggcagaagcagcacgagcgtcagcgtgagatgcagcgtcagcaggagcggctg
gagagacatcgtgtggagaaggagcgacagcgagaggggcggggagaccgggacagagac
agacacagggacagggacagacgt

DBGET integrated database retrieval system