KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_166018Help
Entry
BRAFLDRAFT_166018 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04068  FoxO signaling pathway
bfo04933  AGE-RAGE signaling pathway in diabetic complications
Module
bfo_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    BRAFLDRAFT_166018
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    BRAFLDRAFT_166018
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     BRAFLDRAFT_166018
Protein kinases [BR:bfo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   BRAFLDRAFT_166018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 7249256
NCBI-ProteinID: XP_002597032
JGI: 166018
UniProt: C3Z305
AA seq 261 aa AA seqDB search
VIGLLNVMTPTLTFEDFQDVYLVTPLMGADLNNIVKCQKLTDDHVQFIVYQLLRGLKYIH
SAGIIHKVSIPFDVSLMKTNEILSEFIIENIPSTVDFIDNYHIARRRGPIRRPPEIMLNW
MHYNKTVDIWSVGCIMAELLMGKALFPGTDHIDQLKRIMELVGKPDQEFLQKISSESARI
YVESLPKWQKKDFRGYFSGANPDAVDLLDKMLILDTDKRLTAEQALEHPYMRHYHNPTDE
PTAAAYDDSFEKKELNIAEWR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgattggactgttgaatgttatgacccctactctgacattcgaagatttccaggatgtg
tacctagtgacacccctgatgggtgcagacctgaacaacatcgtgaagtgtcagaagctg
acagacgaccatgtacagttcattgtctaccaactgctcagaggactcaagtacattcac
tcggctgggatcattcacaaagtaagtattccatttgatgttagtttgatgaaaactaat
gaaattttatctgaattcatcatagagaatattccgagtacagtagactttatagataat
tatcatatagccaggcgccgcggaccaatcagaaggcccccagaaatcatgctgaactgg
atgcactacaacaaaacagttgacatctggtctgtaggatgcatcatggctgagctgctg
atggggaaagccctctttccaggaaccgatcacattgatcagttgaagagaatcatggag
ctggtgggaaagcccgatcaagaattcctgcaaaaaatcagctcggagtctgcacgaatc
tacgtggagtcgctccccaagtggcagaagaaggacttccgtgggtactttagcggagcg
aatccggacgctgttgacctgttggacaagatgctgatcttggacacagacaagcgactg
acagcagagcaggccctggagcacccgtacatgcggcattaccacaaccccaccgacgag
ccgaccgcagccgcatacgacgactcctttgagaagaaggaactgaacattgcggagtgg
aga

DBGET integrated database retrieval system