KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_201693Help
Entry
BRAFLDRAFT_201693 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    BRAFLDRAFT_201693
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bfo01001]
    BRAFLDRAFT_201693
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bfo03036]
    BRAFLDRAFT_201693
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     BRAFLDRAFT_201693
Protein kinases [BR:bfo01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   BRAFLDRAFT_201693
Chromosome and associated proteins [BR:bfo03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    BRAFLDRAFT_201693
   Centrosome duplication proteins
    Regulators of centriole replication
     BRAFLDRAFT_201693
  Sister chromatid separation proteins
   Polo kinases
    BRAFLDRAFT_201693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo Thy1
Motif
Other DBs
NCBI-GeneID: 7212416
NCBI-ProteinID: XP_002592903
JGI: 201693
UniProt: C3ZDV8
AA seq 313 aa AA seqDB search
EVPATIADSESGKTYNRLRLLGRGGFAKCYELRDTSTNVLFAGKVIPKTRVAKPAQREKI
DREVALHRTLIHRHVVAFHHSFEDEQNIYIILENCNRKCLANIIRHRKTLTEPEVRYYLR
QVAEGVKYLHGLGIVHRDLKLGNFFLTENMDVKIGDFGLATNAAEEGEDRKRTICGTPNY
IAPEVLQKKGHGYAADMWALGCAIYTMLAGRPPFETASLKTTYARILEGHYVMPTRLVTS
SKALLRALLCKDPLQRLTLDGVTEHDFLTKEFVPTRLPHTACTVEPRFPTKPVTPKLATT
QRCNAFNKKTKTP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gaggtgccagccaccatcgcggactcggaatccggcaagacatacaacaggctccgtctg
ctggggaggggtggcttcgcaaagtgctatgagctgagagacacgtccactaacgtgctg
tttgcggggaaggtcatccccaagactcgggtcgccaaaccggcacagagagaaaagatt
gaccgcgaggtggcgcttcaccgcacgctgatacaccgccatgttgtcgcgttccaccac
agttttgaggacgaacagaacatctacatcattctggagaactgcaacagaaagtgtttg
gccaacatcatccgccaccgcaagaccctaacggagcccgaggtccggtattacctgcgc
caggtggccgagggtgtgaagtacctgcatggcctggggatcgtgcatcgcgacctgaag
ctcgggaacttcttcctgacggagaacatggacgtgaagatcggagacttcgggctggcg
actaacgccgcggaggagggcgaggacaggaaaagaaccatctgtggcacgccgaactac
atcgctccggaggttctgcagaagaagggccacgggtacgccgctgacatgtgggccttg
gggtgtgccatttacaccatgctggccggcaggcctcctttcgagacggcgtccctgaag
accacgtacgcgcgcatcctggaggggcattacgtcatgcctacgcgcctggtgacgtca
tccaaggcgctcctgcgcgcactgctctgtaaggaccccctgcagagactgaccttagac
ggggtcacagaacacgacttcttaaccaaggagttcgtcccgacccgactgcctcacaca
gcctgtacagtagagcccagattccccaccaaacccgtcactcccaaactggcgacaacg
caaaggtgcaacgccttcaacaagaagaccaaaacacca

DBGET integrated database retrieval system